BLASTX nr result
ID: Ziziphus21_contig00049692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049692 (171 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091970.1| hypothetical protein L484_003783 [Morus nota... 59 2e-06 >ref|XP_010091970.1| hypothetical protein L484_003783 [Morus notabilis] gi|587858333|gb|EXB48300.1| hypothetical protein L484_003783 [Morus notabilis] Length = 1110 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -1 Query: 144 SKSKAIVRSSPQ---VAESDDILWSISSNVHE*AANKRDLIISHTGNPDII 1 SKSKAIV+SSP + DILWSISSNVHE +N DL+ HT NPD+I Sbjct: 1051 SKSKAIVKSSPLGILKVQPGDILWSISSNVHELGSNWTDLVAPHTRNPDVI 1101