BLASTX nr result
ID: Ziziphus21_contig00049668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049668 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG09081.1| hypothetical protein MPH_13936 [Macrophomina phas... 125 9e-27 gb|EKG09510.1| hypothetical protein MPH_13444 [Macrophomina phas... 72 2e-10 >gb|EKG09081.1| hypothetical protein MPH_13936 [Macrophomina phaseolina MS6] Length = 438 Score = 125 bits (315), Expect = 9e-27 Identities = 62/92 (67%), Positives = 73/92 (79%) Frame = -3 Query: 278 KRRASRENLAASSPKKPAVVNPASFSSEIEQLRAVVDQLRHQILNHPVAPGSPTEDGSVL 99 KRRASREN A PKKPAV++P S E+E+LRA+VDQLR ++LNHP P SPTEDGS+L Sbjct: 213 KRRASRENSAIPEPKKPAVIDPLYSSPELEKLRAMVDQLRQEVLNHPNVPASPTEDGSIL 272 Query: 98 DRFDAIERRLSALEEQSAENRLVTARTVDEAN 3 DR D IERRLSALEEQ+ + RLVT + VD AN Sbjct: 273 DRLDTIERRLSALEEQAVKERLVTTKIVDGAN 304 >gb|EKG09510.1| hypothetical protein MPH_13444 [Macrophomina phaseolina MS6] Length = 306 Score = 71.6 bits (174), Expect = 2e-10 Identities = 41/72 (56%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = -3 Query: 278 KRRASRENLAASSPKK---PAVVNPASFSSEIEQLRAVVDQLRHQILNHPVAPGSPTEDG 108 KRRASREN A SPKK A V+P+ SE +LRA + QLR QI + V PG+PTEDG Sbjct: 199 KRRASRENSGAPSPKKLSAAAAVSPSP-PSEFVRLRAEIGQLRKQIQSPSVVPGTPTEDG 257 Query: 107 SVLDRFDAIERR 72 +LDR DA+E R Sbjct: 258 HILDRLDALENR 269