BLASTX nr result
ID: Ziziphus21_contig00049599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049599 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012255586.1| PREDICTED: RING finger protein nhl-1 isoform... 59 1e-06 ref|XP_012255582.1| PREDICTED: mucin-22 isoform X1 [Athalia rosa... 59 1e-06 >ref|XP_012255586.1| PREDICTED: RING finger protein nhl-1 isoform X2 [Athalia rosae] Length = 1259 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 1/85 (1%) Frame = -2 Query: 258 SGVRNTGAAFTTDELRQQYLTRT-GRESSSKGTADSNSGNSSPRTKVPPDTKKEVTPTIG 82 SG+R+TGA FT +E++Q++L+R +++ +A N+G ++ R VPP + T T Sbjct: 562 SGIRSTGAPFTAEEMKQKFLSRAPATGTTTTVSAAQNAGGNTGRDPVPP--PQTTTTTTP 619 Query: 81 ASRFQSRFLSGANRTNSTSSPINEK 7 FQSRFL G NR T P E+ Sbjct: 620 QRPFQSRFLGGGNRAAPTPPPAREE 644 >ref|XP_012255582.1| PREDICTED: mucin-22 isoform X1 [Athalia rosae] gi|817067386|ref|XP_012255583.1| PREDICTED: mucin-22 isoform X1 [Athalia rosae] gi|817067388|ref|XP_012255584.1| PREDICTED: mucin-22 isoform X1 [Athalia rosae] gi|817067390|ref|XP_012255585.1| PREDICTED: mucin-22 isoform X1 [Athalia rosae] Length = 1336 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 1/85 (1%) Frame = -2 Query: 258 SGVRNTGAAFTTDELRQQYLTRT-GRESSSKGTADSNSGNSSPRTKVPPDTKKEVTPTIG 82 SG+R+TGA FT +E++Q++L+R +++ +A N+G ++ R VPP + T T Sbjct: 562 SGIRSTGAPFTAEEMKQKFLSRAPATGTTTTVSAAQNAGGNTGRDPVPP--PQTTTTTTP 619 Query: 81 ASRFQSRFLSGANRTNSTSSPINEK 7 FQSRFL G NR T P E+ Sbjct: 620 QRPFQSRFLGGGNRAAPTPPPAREE 644