BLASTX nr result
ID: Ziziphus21_contig00049464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049464 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014239845.1| PREDICTED: macrophage colony-stimulating fac... 56 9e-06 >ref|XP_014239845.1| PREDICTED: macrophage colony-stimulating factor 1 receptor 2-like [Cimex lectularius] Length = 1098 Score = 56.2 bits (134), Expect = 9e-06 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = -3 Query: 247 RKKRRRILFSSTQPVPIDALQSQT-SVYNNFQPIEQSFPKDHIVPFLDFGRKIGGSGTLP 71 RK+RR + ST +P Q+ + ++YN+F+P+EQ P+DH++PFLDFGRK+ +G+ P Sbjct: 111 RKRRRDPVNPSTTGLP----QTMSYNLYNHFRPLEQDVPQDHLLPFLDFGRKL-STGSTP 165 Query: 70 RGNVNFVDSLLT 35 G VN ++S T Sbjct: 166 SG-VNSIESSST 176