BLASTX nr result
ID: Ziziphus21_contig00049452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049452 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10515.1| hypothetical protein MPH_12373 [Macrophomina phas... 57 7e-06 >gb|EKG10515.1| hypothetical protein MPH_12373 [Macrophomina phaseolina MS6] Length = 161 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -1 Query: 410 SGRVPEGGEAMVAATVPPGKSVNYLVLASDSCGVSVSSNQVLPDGWS 270 +G +PEGGE V P ++ Y V ASD+CGVS++SNQVLPDGWS Sbjct: 111 NGCIPEGGEGGVRV---PSRNQQYFVEASDTCGVSLNSNQVLPDGWS 154