BLASTX nr result
ID: Ziziphus21_contig00049442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049442 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV85335.1| hypothetical protein PV11_01038 [Exophiala sideris] 57 7e-06 >gb|KIV85335.1| hypothetical protein PV11_01038 [Exophiala sideris] Length = 80 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 312 YDKPAKTADGAMTTQDSSDAHTLKGTSADPNPPE 211 YDKPAKT DGAMTTQDSSDAHT+KGT A+ E Sbjct: 13 YDKPAKTVDGAMTTQDSSDAHTVKGTPAEGTAAE 46