BLASTX nr result
ID: Ziziphus21_contig00049372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049372 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014173982.1| adenylyl cyclase-associated protein [Grosman... 59 2e-06 gb|KIW08720.1| hypothetical protein PV09_00663 [Verruconis gallo... 57 4e-06 >ref|XP_014173982.1| adenylyl cyclase-associated protein [Grosmannia clavigera kw1407] gi|320592061|gb|EFX04500.1| adenylyl cyclase-associated protein [Grosmannia clavigera kw1407] Length = 566 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 315 PLPIMAQNNMHNLTTLIKRLVAATSRLEDIASSTFE 208 PL MA NNMHNLTTLIKRL AAT+RLEDIASST E Sbjct: 2 PLANMATNNMHNLTTLIKRLEAATARLEDIASSTIE 37 >gb|KIW08720.1| hypothetical protein PV09_00663 [Verruconis gallopava] Length = 547 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 303 MAQNNMHNLTTLIKRLVAATSRLEDIASSTFE 208 MA NNMHNLTTLIKRL AATSRLEDIASS FE Sbjct: 1 MATNNMHNLTTLIKRLEAATSRLEDIASSAFE 32