BLASTX nr result
ID: Ziziphus21_contig00049361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049361 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21916.1| DNA recombination/repair protein Rad52 [Macrophom... 104 3e-20 gb|KEQ81731.1| hypothetical protein M438DRAFT_357680 [Aureobasid... 57 4e-06 ref|XP_013348620.1| hypothetical protein AUEXF2481DRAFT_131 [Aur... 56 9e-06 >gb|EKG21916.1| DNA recombination/repair protein Rad52 [Macrophomina phaseolina MS6] Length = 538 Score = 104 bits (259), Expect = 3e-20 Identities = 49/60 (81%), Positives = 52/60 (86%) Frame = -3 Query: 273 RIGMPNAGQSPYANRQSYKPPVLKRPADVPARPALADMTNVPGDGPSDGAGSKKPRVGES 94 RIGMPNAGQSPYANRQSYKPPVLKRPA+ PARPALADMTNVP D P++ SKKPRV S Sbjct: 479 RIGMPNAGQSPYANRQSYKPPVLKRPAEAPARPALADMTNVPSDEPAEDTDSKKPRVDAS 538 >gb|KEQ81731.1| hypothetical protein M438DRAFT_357680 [Aureobasidium pullulans EXF-150] Length = 544 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/63 (55%), Positives = 39/63 (61%), Gaps = 4/63 (6%) Frame = -3 Query: 273 RIGMPNAGQSPYANRQSYKPPVLKR--PADVP-ARPALADMTNV-PGDGPSDGAGSKKPR 106 RIGMP QSP ANR +YKPP +KR PA+ P RP LADM+NV DG SD K Sbjct: 469 RIGMPGMQQSPLANRSAYKPPAMKRPLPAEAPVGRPPLADMSNVQQTDGASDPKKLKMDA 528 Query: 105 VGE 97 V E Sbjct: 529 VQE 531 >ref|XP_013348620.1| hypothetical protein AUEXF2481DRAFT_131 [Aureobasidium subglaciale EXF-2481] gi|662542873|gb|KER00171.1| hypothetical protein AUEXF2481DRAFT_131 [Aureobasidium subglaciale EXF-2481] Length = 546 Score = 56.2 bits (134), Expect = 9e-06 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = -3 Query: 273 RIGMPNA-GQSPYANRQSYKPPVLKR--PADVPA-RPALADMTNV-PGDGPSDGAGSKKP 109 RIGMP QSP ANR +YKPP +KR PAD PA RP LADM+NV DG SD KKP Sbjct: 471 RIGMPGGMQQSPLANRSAYKPPAMKRPLPADNPAGRPPLADMSNVLQTDGASD---PKKP 527 Query: 108 RV 103 ++ Sbjct: 528 KL 529