BLASTX nr result
ID: Ziziphus21_contig00049359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049359 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16670.1| Taurine catabolism dioxygenase TauD/TfdA [Macroph... 125 1e-26 ref|XP_007579882.1| putative pyoverdine dityrosine biosynthesis ... 119 9e-25 gb|KKY22345.1| putative pyoverdine dityrosine biosynthesis [Dipl... 118 2e-24 ref|XP_007344592.1| putative pyoverdine/dityrosine biosynthesis ... 85 2e-14 ref|XP_004352680.1| pyoverdine/dityrosine biosynthesis protein [... 79 1e-12 >gb|EKG16670.1| Taurine catabolism dioxygenase TauD/TfdA [Macrophomina phaseolina MS6] Length = 637 Score = 125 bits (314), Expect = 1e-26 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = -2 Query: 210 MSVHAVAASKRSPAQIAEDVLSVIESYRLKASPFDPKVISQARETFLPIIQRAVEKQAPL 31 MSVHAVAASKRS AQIAEDVLS+IESYRLKASPFDPK+I QARETFLPIIQRAVEK P+ Sbjct: 1 MSVHAVAASKRSTAQIAEDVLSIIESYRLKASPFDPKIIPQARETFLPIIQRAVEKNTPI 60 Query: 30 SLTLPAFPFK 1 SLTLPAFPFK Sbjct: 61 SLTLPAFPFK 70 >ref|XP_007579882.1| putative pyoverdine dityrosine biosynthesis protein [Neofusicoccum parvum UCRNP2] gi|485929183|gb|EOD52643.1| putative pyoverdine dityrosine biosynthesis protein [Neofusicoccum parvum UCRNP2] Length = 638 Score = 119 bits (298), Expect = 9e-25 Identities = 59/70 (84%), Positives = 67/70 (95%) Frame = -2 Query: 210 MSVHAVAASKRSPAQIAEDVLSVIESYRLKASPFDPKVISQARETFLPIIQRAVEKQAPL 31 MSVHAVAAS+RS AQIA+DVL+VIESYRL+ASPFDPK+I QAR+TFLPIIQRAVE+Q P+ Sbjct: 1 MSVHAVAASQRSLAQIADDVLTVIESYRLRASPFDPKIIPQARDTFLPIIQRAVERQEPI 60 Query: 30 SLTLPAFPFK 1 SLTLPAFPFK Sbjct: 61 SLTLPAFPFK 70 >gb|KKY22345.1| putative pyoverdine dityrosine biosynthesis [Diplodia seriata] Length = 642 Score = 118 bits (295), Expect = 2e-24 Identities = 58/70 (82%), Positives = 64/70 (91%) Frame = -2 Query: 210 MSVHAVAASKRSPAQIAEDVLSVIESYRLKASPFDPKVISQARETFLPIIQRAVEKQAPL 31 MSVH VAASKRS AQ+A+D+L+VIESYRLKASPFDPK I QAR TFLP+IQ+AVEKQ PL Sbjct: 1 MSVHTVAASKRSTAQVADDILAVIESYRLKASPFDPKTIPQARVTFLPLIQKAVEKQTPL 60 Query: 30 SLTLPAFPFK 1 SLTLPAFPFK Sbjct: 61 SLTLPAFPFK 70 >ref|XP_007344592.1| putative pyoverdine/dityrosine biosynthesis protein [Auricularia subglabra TFB-10046 SS5] gi|393239894|gb|EJD47423.1| putative pyoverdine/dityrosine biosynthesis protein [Auricularia subglabra TFB-10046 SS5] Length = 608 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/63 (61%), Positives = 51/63 (80%) Frame = -2 Query: 189 ASKRSPAQIAEDVLSVIESYRLKASPFDPKVISQARETFLPIIQRAVEKQAPLSLTLPAF 10 A+ + Q A+ +L+V+ESYRLKASPFDP +I Q+RETFLP+I+RAVE+Q + TLPAF Sbjct: 2 AAPNTTTQTADAILAVVESYRLKASPFDPAIIPQSRETFLPLIERAVEQQQSVPFTLPAF 61 Query: 9 PFK 1 PFK Sbjct: 62 PFK 64 >ref|XP_004352680.1| pyoverdine/dityrosine biosynthesis protein [Acanthamoeba castellanii str. Neff] gi|440802220|gb|ELR23152.1| pyoverdine/dityrosine biosynthesis protein [Acanthamoeba castellanii str. Neff] Length = 593 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = -2 Query: 168 QIAEDVLSVIESYRLKASPFDPKVISQARETFLPIIQRAVEKQAPLSLTLPAFPFK 1 Q A+ +LSV+ESYRLKASPFD ++ Q RET LP+IQ+AVE + P+S LPAFPFK Sbjct: 6 QTADAILSVVESYRLKASPFDSSIVPQCRETILPLIQKAVEAKEPVSFILPAFPFK 61