BLASTX nr result
ID: Ziziphus21_contig00049313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049313 (246 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014257150.1| PREDICTED: alkyldihydroxyacetonephosphate sy... 56 9e-06 >ref|XP_014257150.1| PREDICTED: alkyldihydroxyacetonephosphate synthase [Cimex lectularius] gi|939273666|ref|XP_014257151.1| PREDICTED: alkyldihydroxyacetonephosphate synthase [Cimex lectularius] gi|939273668|ref|XP_014257152.1| PREDICTED: alkyldihydroxyacetonephosphate synthase [Cimex lectularius] Length = 625 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = -2 Query: 200 SLFLAFHLISGMKSEEKNKVDDDVKWNGWGFTDSMFVVQNNEVYFKGNRYSVGNGQEEPL 21 S F + + I + + K D +KWNGWG+ DS FVV N + F G RY +G E L Sbjct: 28 SKFKSQNQIERINTIVSKKRCDVIKWNGWGYNDSKFVVDNGVIIFTGKRYPIG---EVEL 84 Query: 20 EYFKEW 3 YF EW Sbjct: 85 PYFTEW 90