BLASTX nr result
ID: Ziziphus21_contig00049296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049296 (240 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014283841.1| PREDICTED: T-cell activation inhibitor, mito... 82 1e-13 gb|KDR15586.1| hypothetical protein L798_10531 [Zootermopsis nev... 82 1e-13 ref|XP_014249691.1| PREDICTED: T-cell activation inhibitor, mito... 82 2e-13 ref|XP_002429503.1| conserved hypothetical protein [Pediculus hu... 79 1e-12 ref|XP_012527564.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012341356.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012236614.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012236610.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012174030.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012174027.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_012174023.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_011163654.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_011163653.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_011153507.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_011153506.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_008193681.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 gb|EFA03525.1| hypothetical protein TcasGA2_TC013527 [Tribolium ... 79 2e-12 ref|XP_395914.1| PREDICTED: T-cell activation inhibitor, mitocho... 79 2e-12 ref|XP_006611856.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 ref|XP_006611855.1| PREDICTED: T-cell activation inhibitor, mito... 79 2e-12 >ref|XP_014283841.1| PREDICTED: T-cell activation inhibitor, mitochondrial [Halyomorpha halys] Length = 490 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSER 17 R ++S +IATALRPFYF VHPDLFGKYPSERA+NE+SLQSLSS+IE ++ + Sbjct: 30 RHLTSGEIATALRPFYFSVHPDLFGKYPSERAINESSLQSLSSYIENLQQNK 81 >gb|KDR15586.1| hypothetical protein L798_10531 [Zootermopsis nevadensis] Length = 495 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +SS++++TALRPFYF VHPDLFG+YP+ER VNENSL+ LSS+IET++ RP Sbjct: 33 RFLSSAEVSTALRPFYFSVHPDLFGRYPTERTVNENSLKQLSSYIETLQKNRP 85 >ref|XP_014249691.1| PREDICTED: T-cell activation inhibitor, mitochondrial [Cimex lectularius] Length = 491 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R ++S ++ATALRPFYF VHPDLFGK+P+ERA NENSLQ LSS+I+T++ RP Sbjct: 26 RYLTSGEVATALRPFYFSVHPDLFGKFPTERATNENSLQVLSSYIQTLQQNRP 78 >ref|XP_002429503.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514445|gb|EEB16765.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 384 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/48 (68%), Positives = 45/48 (93%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETV 29 R +SS++++TALRPFYFFVHPDLFG++P ERA+NENSL+ LSS++ET+ Sbjct: 23 RSLSSTEVSTALRPFYFFVHPDLFGQFPEERAINENSLKLLSSYLETL 70 >ref|XP_012527564.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X3 [Monomorium pharaonis] Length = 490 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +++TALRPFYF VHPDLFG+YP++R VNENSL+ LSS +ET++ +RP Sbjct: 17 RALSTGEVSTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSILETLQQKRP 69 >ref|XP_012341356.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Apis florea] Length = 490 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_012236614.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Bombus impatiens] gi|815900998|ref|XP_012236615.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Bombus impatiens] Length = 487 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 13 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 65 >ref|XP_012236610.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus impatiens] gi|815900992|ref|XP_012236611.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus impatiens] gi|815900994|ref|XP_012236612.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus impatiens] Length = 490 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_012174030.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X3 [Bombus terrestris] Length = 484 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_012174027.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Bombus terrestris] gi|808145612|ref|XP_012174028.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Bombus terrestris] gi|808145614|ref|XP_012174029.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Bombus terrestris] Length = 487 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 13 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 65 >ref|XP_012174023.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus terrestris] gi|808145604|ref|XP_012174024.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus terrestris] gi|808145606|ref|XP_012174025.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus terrestris] gi|808145608|ref|XP_012174026.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Bombus terrestris] Length = 490 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_011163654.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Solenopsis invicta] Length = 482 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +++TALRPFYF VHPDLFG+YP++R VNENSL+ LSS +ET++ +RP Sbjct: 17 RALSTGEVSTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSILETLQQKRP 69 >ref|XP_011163653.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Solenopsis invicta] Length = 488 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +++TALRPFYF VHPDLFG+YP++R VNENSL+ LSS +ET++ +RP Sbjct: 17 RALSTGEVSTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSILETLQQKRP 69 >ref|XP_011153507.1| PREDICTED: T-cell activation inhibitor, mitochondrial isoform X2 [Harpegnathos saltator] Length = 483 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +IATALRPFYF VHPDLFG+YP++R VNENSL+ LSS +ET++ ++P Sbjct: 16 RALSTGEIATALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSILETLQQKQP 68 >ref|XP_011153506.1| PREDICTED: T-cell activation inhibitor, mitochondrial isoform X1 [Harpegnathos saltator] Length = 489 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +IATALRPFYF VHPDLFG+YP++R VNENSL+ LSS +ET++ ++P Sbjct: 16 RALSTGEIATALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSILETLQQKQP 68 >ref|XP_008193681.1| PREDICTED: T-cell activation inhibitor, mitochondrial [Tribolium castaneum] Length = 482 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/52 (63%), Positives = 48/52 (92%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSER 17 R +++++++TALRPFYF VHPDLFG+YPS+RA+NENSL+ LSS IET++++R Sbjct: 20 RHLTTTEVSTALRPFYFNVHPDLFGQYPSQRAINENSLKQLSSIIETLQAKR 71 >gb|EFA03525.1| hypothetical protein TcasGA2_TC013527 [Tribolium castaneum] Length = 919 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/52 (63%), Positives = 48/52 (92%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSER 17 R +++++++TALRPFYF VHPDLFG+YPS+RA+NENSL+ LSS IET++++R Sbjct: 457 RHLTTTEVSTALRPFYFNVHPDLFGQYPSQRAINENSLKQLSSIIETLQAKR 508 >ref|XP_395914.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Apis mellifera] Length = 484 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_006611856.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X2 [Apis dorsata] Length = 484 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68 >ref|XP_006611855.1| PREDICTED: T-cell activation inhibitor, mitochondrial-like isoform X1 [Apis dorsata] Length = 490 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = -3 Query: 172 RQMSSSQIATALRPFYFFVHPDLFGKYPSERAVNENSLQSLSSFIETVKSERP 14 R +S+ +I+TALRPFYF VHPDLFG+YP++R VNENSL+ LSS IE+++ +RP Sbjct: 16 RALSTGEISTALRPFYFTVHPDLFGQYPTQRTVNENSLKQLSSIIESLQQQRP 68