BLASTX nr result
ID: Ziziphus21_contig00049138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049138 (251 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG11199.1| Importin-beta [Macrophomina phaseolina MS6] 58 3e-06 >gb|EKG11199.1| Importin-beta [Macrophomina phaseolina MS6] Length = 961 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 227 NQRNGGRVSAFVQERLSPEAKAALVQTMQG 138 +QRNGGRVSAFVQERLSPEAK ALVQTMQG Sbjct: 932 DQRNGGRVSAFVQERLSPEAKTALVQTMQG 961