BLASTX nr result
ID: Ziziphus21_contig00049129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049129 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY18836.1| putative dsdna-dependent atpase [Diplodia seriata] 60 8e-07 gb|EKG12686.1| SNF2-related protein [Macrophomina phaseolina MS6] 59 1e-06 >gb|KKY18836.1| putative dsdna-dependent atpase [Diplodia seriata] Length = 688 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 293 VDYEAMIDDEPLMDVIREDGSRVKFVFSKTTS 198 VD+EA+IDDEPLMDVI+E+GSRVKFVFSKT+S Sbjct: 657 VDFEALIDDEPLMDVIKEEGSRVKFVFSKTSS 688 >gb|EKG12686.1| SNF2-related protein [Macrophomina phaseolina MS6] Length = 931 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 293 VDYEAMIDDEPLMDVIREDGSRVKFVFSKTTS 198 VDYEA+IDDEPLM+VI+E+GSRVKFVFSKT S Sbjct: 900 VDYEALIDDEPLMEVIKENGSRVKFVFSKTVS 931