BLASTX nr result
ID: Ziziphus21_contig00049030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00049030 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG19681.1| hypothetical protein MPH_03062 [Macrophomina phas... 147 3e-33 >gb|EKG19681.1| hypothetical protein MPH_03062 [Macrophomina phaseolina MS6] Length = 754 Score = 147 bits (371), Expect = 3e-33 Identities = 70/90 (77%), Positives = 78/90 (86%) Frame = -3 Query: 270 GTPANKYILLFTLGFVMPLCWIIAAFIPLPTRPNDELERLGGKMPEKTNEKGKERAQPGT 91 GTPANKYILLFTLGFV+PLCWIIAAF+PLP RPN+E ERLGG M EK +KGKER+ PG Sbjct: 620 GTPANKYILLFTLGFVLPLCWIIAAFLPLPPRPNEEHERLGGVMAEKGQDKGKERSLPGV 679 Query: 90 EQQPGAGVMMGNETNIEAGLGLDLRNTIQE 1 +QQ AGV+MGN+TNIEAGLGLDLRN QE Sbjct: 680 QQQSVAGVVMGNQTNIEAGLGLDLRNATQE 709