BLASTX nr result
ID: Ziziphus21_contig00048632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00048632 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007586512.1| putative cenp-o kinetochore centromere compo... 58 5e-11 >ref|XP_007586512.1| putative cenp-o kinetochore centromere component protein [Neofusicoccum parvum UCRNP2] gi|485919847|gb|EOD46040.1| putative cenp-o kinetochore centromere component protein [Neofusicoccum parvum UCRNP2] Length = 207 Score = 57.8 bits (138), Expect(2) = 5e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 261 IHHFIHKDSLTQLLYEVAADSLYHQHGGLS 172 IHHFIHKDSLTQLLYEVAA+SLY QHG L+ Sbjct: 42 IHHFIHKDSLTQLLYEVAAESLYQQHGRLA 71 Score = 36.2 bits (82), Expect(2) = 5e-11 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = -1 Query: 131 REQIESLEHRRXXXXXXXXXSQNTLERIRRDNAKSNSTTSPAS 3 R ESLE RR SQNTL RI+R +A S+S +SPA+ Sbjct: 69 RLAFESLERRRSVLSSTLLSSQNTLARIQRASANSDSASSPAA 111