BLASTX nr result
ID: Ziziphus21_contig00047867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047867 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585334.1| putative duf962 domain protein [Neofusicoccu... 107 3e-21 gb|KKY26142.1| hypothetical protein UCDDS831_g01652 [Diplodia se... 105 1e-20 gb|EKG22245.1| hypothetical protein MPH_00424 [Macrophomina phas... 104 2e-20 ref|XP_013430521.1| DUF962-domain-containing protein [Aureobasid... 96 8e-18 gb|KEQ80251.1| DUF962 domain-containing protein [Aureobasidium p... 96 1e-17 gb|KEQ61776.1| DUF962-domain-containing protein [Aureobasidium m... 95 2e-17 ref|XP_013343060.1| hypothetical protein AUEXF2481DRAFT_5497 [Au... 93 9e-17 gb|EME49104.1| hypothetical protein DOTSEDRAFT_142755 [Dothistro... 90 6e-16 ref|XP_007777287.1| hypothetical protein W97_01188 [Coniosporium... 89 2e-15 dbj|GAM90898.1| hypothetical protein ANO11243_089440 [fungal sp.... 87 4e-15 ref|XP_007679481.1| hypothetical protein BAUCODRAFT_233654 [Baud... 86 1e-14 ref|XP_014558447.1| hypothetical protein COCVIDRAFT_36209 [Bipol... 84 3e-14 ref|XP_008026075.1| hypothetical protein SETTUDRAFT_169243 [Seto... 84 3e-14 ref|XP_007685847.1| hypothetical protein COCMIDRAFT_34870 [Bipol... 84 4e-14 ref|XP_007708264.1| hypothetical protein COCCADRAFT_33349 [Bipol... 84 4e-14 ref|XP_007701466.1| hypothetical protein COCSADRAFT_120491 [Bipo... 84 4e-14 ref|XP_003306556.1| hypothetical protein PTT_19732 [Pyrenophora ... 84 4e-14 ref|XP_003839121.1| similar to DUF962 domain protein [Leptosphae... 83 7e-14 gb|EMF17008.1| DUF962 domain-containing protein [Sphaerulina mus... 82 2e-13 ref|XP_007921136.1| hypothetical protein MYCFIDRAFT_125332 [Pseu... 81 3e-13 >ref|XP_007585334.1| putative duf962 domain protein [Neofusicoccum parvum UCRNP2] gi|485921483|gb|EOD47189.1| putative duf962 domain protein [Neofusicoccum parvum UCRNP2] Length = 198 Score = 107 bits (267), Expect = 3e-21 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL FYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAI++PDALSI Sbjct: 1 MALNLEKQLTFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAITVPDALSI 54 >gb|KKY26142.1| hypothetical protein UCDDS831_g01652 [Diplodia seriata] Length = 197 Score = 105 bits (263), Expect = 1e-20 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL FYGSYHHNPVNIGVHITCVPLIMMTAFLFL+NTPA++LPDAL+I Sbjct: 1 MALNLEKQLTFYGSYHHNPVNIGVHITCVPLIMMTAFLFLSNTPAVALPDALTI 54 >gb|EKG22245.1| hypothetical protein MPH_00424 [Macrophomina phaseolina MS6] Length = 199 Score = 104 bits (260), Expect = 2e-20 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -3 Query: 157 LNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 LNLE+QL FYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPA+S+PDALSI Sbjct: 5 LNLEKQLTFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAVSVPDALSI 56 >ref|XP_013430521.1| DUF962-domain-containing protein [Aureobasidium namibiae CBS 147.97] gi|662518649|gb|KEQ76209.1| DUF962-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 200 Score = 96.3 bits (238), Expect = 8e-18 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QL+FYGSYHHNP+NI +HITCVPLI++TAFLF NTPAI LPDA++I Sbjct: 1 MSLNLEKQLLFYGSYHHNPINIAIHITCVPLILLTAFLFCTNTPAIPLPDAITI 54 >gb|KEQ80251.1| DUF962 domain-containing protein [Aureobasidium pullulans EXF-150] Length = 202 Score = 95.9 bits (237), Expect = 1e-17 Identities = 40/54 (74%), Positives = 50/54 (92%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QL+FYGSYHHNP+N+ +HITCVPLI++TAFLF NTPAI LPDA++I Sbjct: 1 MSLNLEKQLLFYGSYHHNPINVAIHITCVPLILLTAFLFCTNTPAIPLPDAITI 54 >gb|KEQ61776.1| DUF962-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 200 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/54 (74%), Positives = 50/54 (92%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QL+FYGSYHHNPVN+ +HITCVPLI++TAFLF NTPA+ LPDA++I Sbjct: 1 MSLNLEKQLLFYGSYHHNPVNVAIHITCVPLILLTAFLFCTNTPALPLPDAVTI 54 >ref|XP_013343060.1| hypothetical protein AUEXF2481DRAFT_5497 [Aureobasidium subglaciale EXF-2481] gi|662537292|gb|KEQ94601.1| hypothetical protein AUEXF2481DRAFT_5497 [Aureobasidium subglaciale EXF-2481] Length = 200 Score = 92.8 bits (229), Expect = 9e-17 Identities = 39/54 (72%), Positives = 49/54 (90%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QL+FYGSYHHNP+NI +HITCVPLI++TAFLF NTP I LP+A++I Sbjct: 1 MSLNLEKQLLFYGSYHHNPINIAIHITCVPLILLTAFLFCTNTPEIPLPEAITI 54 >gb|EME49104.1| hypothetical protein DOTSEDRAFT_142755 [Dothistroma septosporum NZE10] Length = 203 Score = 90.1 bits (222), Expect = 6e-16 Identities = 39/54 (72%), Positives = 49/54 (90%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLERQL+FYGSYHH+PVNIG+HIT VP++++T FLF NTPA+++PD LSI Sbjct: 1 MALNLERQLLFYGSYHHDPVNIGIHITFVPILLLTGFLFATNTPALAVPDWLSI 54 >ref|XP_007777287.1| hypothetical protein W97_01188 [Coniosporium apollinis CBS 100218] gi|494824716|gb|EON61970.1| hypothetical protein W97_01188 [Coniosporium apollinis CBS 100218] Length = 201 Score = 88.6 bits (218), Expect = 2e-15 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLP 17 M+LNLE+QL FYG+YHH+PVNIG+H+ CVPLIMMTAFLF NTPA++LP Sbjct: 1 MSLNLEKQLAFYGAYHHDPVNIGIHMACVPLIMMTAFLFFTNTPALALP 49 >dbj|GAM90898.1| hypothetical protein ANO11243_089440 [fungal sp. No.11243] Length = 195 Score = 87.4 bits (215), Expect = 4e-15 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL FYG+YHHNP+NI +HITCVPLI++T LF NTPA+++PD L + Sbjct: 1 MALNLEKQLQFYGAYHHNPINIAIHITCVPLILITGILFATNTPALTVPDYLQV 54 >ref|XP_007679481.1| hypothetical protein BAUCODRAFT_233654 [Baudoinia panamericana UAMH 10762] gi|449297214|gb|EMC93232.1| hypothetical protein BAUCODRAFT_233654 [Baudoinia panamericana UAMH 10762] Length = 206 Score = 85.9 bits (211), Expect = 1e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL FYG+YHH+PVN+G+H+TCVP+I++TAFLF NTPA+ P L++ Sbjct: 1 MALNLEKQLQFYGAYHHDPVNVGIHVTCVPMILITAFLFGTNTPALPFPSWLTV 54 >ref|XP_014558447.1| hypothetical protein COCVIDRAFT_36209 [Bipolaris victoriae FI3] gi|578491452|gb|EUN28859.1| hypothetical protein COCVIDRAFT_36209 [Bipolaris victoriae FI3] Length = 192 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LSI Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHMLCVPPILLTSFLLLTNTPAVPLPSWLSI 54 >ref|XP_008026075.1| hypothetical protein SETTUDRAFT_169243 [Setosphaeria turcica Et28A] gi|482809674|gb|EOA86483.1| hypothetical protein SETTUDRAFT_169243 [Setosphaeria turcica Et28A] Length = 192 Score = 84.3 bits (207), Expect = 3e-14 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LS+ Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHVLCVPPILLTSFLLLTNTPAVPLPTWLSV 54 >ref|XP_007685847.1| hypothetical protein COCMIDRAFT_34870 [Bipolaris oryzae ATCC 44560] gi|576934120|gb|EUC47638.1| hypothetical protein COCMIDRAFT_34870 [Bipolaris oryzae ATCC 44560] Length = 192 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LS+ Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHMLCVPPILLTSFLLLTNTPAVPLPSWLSV 54 >ref|XP_007708264.1| hypothetical protein COCCADRAFT_33349 [Bipolaris zeicola 26-R-13] gi|576923319|gb|EUC37438.1| hypothetical protein COCCADRAFT_33349 [Bipolaris zeicola 26-R-13] Length = 192 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LS+ Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHMLCVPPILLTSFLLLTNTPAVPLPSWLSV 54 >ref|XP_007701466.1| hypothetical protein COCSADRAFT_120491 [Bipolaris sorokiniana ND90Pr] gi|451849959|gb|EMD63262.1| hypothetical protein COCSADRAFT_120491 [Bipolaris sorokiniana ND90Pr] Length = 192 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LS+ Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHMLCVPPILLTSFLLLTNTPAVPLPSWLSV 54 >ref|XP_003306556.1| hypothetical protein PTT_19732 [Pyrenophora teres f. teres 0-1] gi|311315890|gb|EFQ85354.1| hypothetical protein PTT_19732 [Pyrenophora teres f. teres 0-1] Length = 192 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+H+ CVP I++T+FL L NTPA+ LP LS+ Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHMLCVPPILLTSFLLLTNTPAVPLPSWLSV 54 >ref|XP_003839121.1| similar to DUF962 domain protein [Leptosphaeria maculans JN3] gi|312215690|emb|CBX95642.1| similar to DUF962 domain protein [Leptosphaeria maculans JN3] Length = 192 Score = 83.2 bits (204), Expect = 7e-14 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 M+LNLE+QLVFYG+YHHN VN+G+HI CVP I++T+FL L NTP + LP LSI Sbjct: 1 MSLNLEKQLVFYGAYHHNKVNVGIHILCVPPILLTSFLLLTNTPNVPLPSWLSI 54 >gb|EMF17008.1| DUF962 domain-containing protein [Sphaerulina musiva SO2202] Length = 197 Score = 82.0 bits (201), Expect = 2e-13 Identities = 33/54 (61%), Positives = 47/54 (87%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL+FYGSYHH+PVN+G+HI VP++++T FLF NTPA+ +P+ L++ Sbjct: 1 MALNLEKQLLFYGSYHHDPVNVGIHIVFVPILLLTGFLFGTNTPALPIPEWLTV 54 >ref|XP_007921136.1| hypothetical protein MYCFIDRAFT_125332 [Pseudocercospora fijiensis CIRAD86] gi|452988084|gb|EME87839.1| hypothetical protein MYCFIDRAFT_125332 [Pseudocercospora fijiensis CIRAD86] Length = 203 Score = 80.9 bits (198), Expect = 3e-13 Identities = 33/54 (61%), Positives = 46/54 (85%) Frame = -3 Query: 163 MALNLERQLVFYGSYHHNPVNIGVHITCVPLIMMTAFLFLANTPAISLPDALSI 2 MALNLE+QL+FYGSYHH+PVN+G+HI VP++++T FLF NTPA+ +P+ L + Sbjct: 1 MALNLEKQLLFYGSYHHDPVNVGIHIIFVPMLLLTGFLFGTNTPALPVPEWLEV 54