BLASTX nr result
ID: Ziziphus21_contig00046773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046773 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY17129.1| putative transcription initiation factor subunit ... 81 3e-13 ref|XP_007581377.1| putative transcription initiation factor sub... 78 2e-12 ref|XP_003842305.1| similar to transcription initiation factor s... 77 5e-12 ref|XP_003306448.1| hypothetical protein PTT_19590 [Pyrenophora ... 77 5e-12 ref|XP_001940350.1| transcription initiation factor TFIID subuni... 77 5e-12 gb|EKG20428.1| YEATS domain-containing protein [Macrophomina pha... 76 9e-12 gb|KNG45448.1| glycosyltransferase family 15 protein [Stemphyliu... 75 2e-11 ref|XP_007682308.1| hypothetical protein COCMIDRAFT_366 [Bipolar... 75 2e-11 ref|XP_008022261.1| hypothetical protein SETTUDRAFT_167273 [Seto... 75 2e-11 ref|XP_007712435.1| hypothetical protein COCCADRAFT_5192 [Bipola... 75 2e-11 ref|XP_007705390.1| hypothetical protein COCSADRAFT_165173 [Bipo... 75 2e-11 gb|KIW00231.1| hypothetical protein PV09_08269 [Verruconis gallo... 73 7e-11 gb|KJX99951.1| Transcription initiation factor TFIID subunit lik... 73 1e-10 ref|XP_007923234.1| hypothetical protein MYCFIDRAFT_186230 [Pseu... 73 1e-10 gb|EME47635.1| hypothetical protein DOTSEDRAFT_69554 [Dothistrom... 73 1e-10 ref|XP_003855684.1| hypothetical protein MYCGRDRAFT_99027 [Zymos... 73 1e-10 ref|XP_001800917.1| hypothetical protein SNOG_10654 [Parastagono... 72 1e-10 ref|XP_013342320.1| hypothetical protein AUEXF2481DRAFT_41491 [A... 70 5e-10 gb|KNG84833.1| transcription factor TFIIF complex subunit [Asper... 69 1e-09 gb|KJK68517.1| YEATS family protein [Aspergillus parasiticus SU-... 69 1e-09 >gb|KKY17129.1| putative transcription initiation factor subunit [Diplodia seriata] Length = 243 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 DTYTKNDVENGEFHVDLYTLPD LVK+LWDFTAQRTDL Sbjct: 206 DTYTKNDVENGEFHVDLYTLPDNLVKMLWDFTAQRTDL 243 >ref|XP_007581377.1| putative transcription initiation factor subunit protein [Neofusicoccum parvum UCRNP2] gi|485927012|gb|EOD51147.1| putative transcription initiation factor subunit protein [Neofusicoccum parvum UCRNP2] Length = 229 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 DTYTKNDVENGEFHVDLYTLPD LVK+LWDFT QRT+L Sbjct: 192 DTYTKNDVENGEFHVDLYTLPDNLVKMLWDFTTQRTEL 229 >ref|XP_003842305.1| similar to transcription initiation factor subunit [Leptosphaeria maculans JN3] gi|312218881|emb|CBX98826.1| similar to transcription initiation factor subunit [Leptosphaeria maculans JN3] Length = 225 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA +TDL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKTDL 225 >ref|XP_003306448.1| hypothetical protein PTT_19590 [Pyrenophora teres f. teres 0-1] gi|311316061|gb|EFQ85472.1| hypothetical protein PTT_19590 [Pyrenophora teres f. teres 0-1] Length = 225 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA +TDL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKTDL 225 >ref|XP_001940350.1| transcription initiation factor TFIID subunit 14 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976443|gb|EDU43069.1| transcription initiation factor TFIID subunit 14 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 225 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA +TDL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKTDL 225 >gb|EKG20428.1| YEATS domain-containing protein [Macrophomina phaseolina MS6] Length = 229 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 DTYTKNDVENGEFHVDLYTLPD+LVK LWDFTA RT+L Sbjct: 192 DTYTKNDVENGEFHVDLYTLPDSLVKQLWDFTAARTEL 229 >gb|KNG45448.1| glycosyltransferase family 15 protein [Stemphylium lycopersici] Length = 1693 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA + DL Sbjct: 1656 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKVDL 1693 >ref|XP_007682308.1| hypothetical protein COCMIDRAFT_366 [Bipolaris oryzae ATCC 44560] gi|576937666|gb|EUC51153.1| hypothetical protein COCMIDRAFT_366 [Bipolaris oryzae ATCC 44560] Length = 225 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA + DL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKVDL 225 >ref|XP_008022261.1| hypothetical protein SETTUDRAFT_167273 [Setosphaeria turcica Et28A] gi|482813715|gb|EOA90406.1| hypothetical protein SETTUDRAFT_167273 [Setosphaeria turcica Et28A] Length = 225 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA + DL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKVDL 225 >ref|XP_007712435.1| hypothetical protein COCCADRAFT_5192 [Bipolaris zeicola 26-R-13] gi|928528534|ref|XP_014083064.1| hypothetical protein COCC4DRAFT_36742 [Bipolaris maydis ATCC 48331] gi|953440419|ref|XP_014562281.1| hypothetical protein COCVIDRAFT_21872 [Bipolaris victoriae FI3] gi|451998169|gb|EMD90634.1| hypothetical protein COCHEDRAFT_1215596 [Bipolaris maydis C5] gi|477592084|gb|ENI09155.1| hypothetical protein COCC4DRAFT_36742 [Bipolaris maydis ATCC 48331] gi|576919078|gb|EUC33260.1| hypothetical protein COCCADRAFT_5192 [Bipolaris zeicola 26-R-13] gi|578495455|gb|EUN32837.1| hypothetical protein COCVIDRAFT_21872 [Bipolaris victoriae FI3] Length = 225 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA + DL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKVDL 225 >ref|XP_007705390.1| hypothetical protein COCSADRAFT_165173 [Bipolaris sorokiniana ND90Pr] gi|451845615|gb|EMD58927.1| hypothetical protein COCSADRAFT_165173 [Bipolaris sorokiniana ND90Pr] Length = 225 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWDFTA + DL Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDFTASKVDL 225 >gb|KIW00231.1| hypothetical protein PV09_08269 [Verruconis gallopava] Length = 236 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 DTYTKNDVENGEFHVDLYTLPD+LVK LWDFT+ + D+ Sbjct: 199 DTYTKNDVENGEFHVDLYTLPDSLVKQLWDFTSSKVDM 236 >gb|KJX99951.1| Transcription initiation factor TFIID subunit like protein [Zymoseptoria brevis] Length = 234 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD L+K+LWDFT +R D+ Sbjct: 193 ETYTKNDVENGEFHVDLYTLPDPLIKMLWDFTEKRVDM 230 >ref|XP_007923234.1| hypothetical protein MYCFIDRAFT_186230 [Pseudocercospora fijiensis CIRAD86] gi|452985966|gb|EME85722.1| hypothetical protein MYCFIDRAFT_186230 [Pseudocercospora fijiensis CIRAD86] Length = 184 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD L+K+LWDFT +R D+ Sbjct: 143 ETYTKNDVENGEFHVDLYTLPDQLIKMLWDFTEKRVDM 180 >gb|EME47635.1| hypothetical protein DOTSEDRAFT_69554 [Dothistroma septosporum NZE10] Length = 233 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD L+K+LWDFT +R D+ Sbjct: 192 ETYTKNDVENGEFHVDLYTLPDQLIKMLWDFTEKRVDM 229 >ref|XP_003855684.1| hypothetical protein MYCGRDRAFT_99027 [Zymoseptoria tritici IPO323] gi|339475568|gb|EGP90660.1| hypothetical protein MYCGRDRAFT_99027 [Zymoseptoria tritici IPO323] Length = 234 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD L+K+LWDFT +R D+ Sbjct: 193 ETYTKNDVENGEFHVDLYTLPDPLIKMLWDFTEKRVDM 230 >ref|XP_001800917.1| hypothetical protein SNOG_10654 [Parastagonospora nodorum SN15] gi|111060928|gb|EAT82048.1| hypothetical protein SNOG_10654 [Parastagonospora nodorum SN15] Length = 225 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 +TYTKNDVENGEFHVDLYTLPD+LVK+LWD+TA + +L Sbjct: 188 ETYTKNDVENGEFHVDLYTLPDSLVKMLWDYTASKVEL 225 >ref|XP_013342320.1| hypothetical protein AUEXF2481DRAFT_41491 [Aureobasidium subglaciale EXF-2481] gi|662536446|gb|KEQ93758.1| hypothetical protein AUEXF2481DRAFT_41491 [Aureobasidium subglaciale EXF-2481] Length = 230 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQRTDL 283 DTYTKNDVENGEFHVDLYTLPD L+K+LWDF Q+ ++ Sbjct: 190 DTYTKNDVENGEFHVDLYTLPDQLIKMLWDFVNQKVNI 227 >gb|KNG84833.1| transcription factor TFIIF complex subunit [Aspergillus nomius NRRL 13137] Length = 186 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQR 292 D+YTKNDVE GEFHVDLYTLPDTL+K+LWDFT ++ Sbjct: 149 DSYTKNDVEQGEFHVDLYTLPDTLIKMLWDFTQEK 183 >gb|KJK68517.1| YEATS family protein [Aspergillus parasiticus SU-1] gi|914753349|gb|KOC07514.1| transcription factor TFIIF complex subunit [Aspergillus flavus AF70] Length = 231 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 396 DTYTKNDVENGEFHVDLYTLPDTLVKLLWDFTAQR 292 D+YTKNDVE GEFHVDLYTLPDTL+K+LWDFT ++ Sbjct: 194 DSYTKNDVEQGEFHVDLYTLPDTLIKMLWDFTQEK 228