BLASTX nr result
ID: Ziziphus21_contig00046478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046478 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_043914891.1| hypothetical protein [Candidatus Regiella in... 85 2e-14 >ref|WP_043914891.1| hypothetical protein [Candidatus Regiella insecticola] Length = 106 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 163 ITDPQTGVAQDSLVARAAMCVRLVDVRITCGLHDDAQLAAVFIDPRAK 20 + DPQTGVA+D V AAMCVRLVDVRITCGLHDDAQ+AAVFIDPRAK Sbjct: 59 VYDPQTGVARDPRVTEAAMCVRLVDVRITCGLHDDAQIAAVFIDPRAK 106