BLASTX nr result
ID: Ziziphus21_contig00046471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046471 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20556.1| hypothetical protein MPH_02083 [Macrophomina phas... 97 5e-18 ref|XP_007584520.1| hypothetical protein UCRNP2_5244 [Neofusicoc... 94 5e-17 gb|KKY20956.1| hypothetical protein UCDDS831_g04451 [Diplodia se... 83 9e-14 >gb|EKG20556.1| hypothetical protein MPH_02083 [Macrophomina phaseolina MS6] Length = 273 Score = 97.1 bits (240), Expect = 5e-18 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 381 LEYSEKERQAIATTAYYDRKEAQLQATPDQAAYLPEGYFLEQRNAPLITSY 229 LEY+EKERQAIATTAYYDRK+AQ+Q TPDQAA+LPEGYFLEQRN PLITSY Sbjct: 223 LEYTEKERQAIATTAYYDRKKAQIQTTPDQAAFLPEGYFLEQRNVPLITSY 273 >ref|XP_007584520.1| hypothetical protein UCRNP2_5244 [Neofusicoccum parvum UCRNP2] gi|485922602|gb|EOD48005.1| hypothetical protein UCRNP2_5244 [Neofusicoccum parvum UCRNP2] Length = 271 Score = 93.6 bits (231), Expect = 5e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -3 Query: 381 LEYSEKERQAIATTAYYDRKEAQLQATPDQAAYLPEGYFLEQRNAPLITSY 229 LEY+EKERQAIATTAYYDRKE L ATPDQAAYLPEGYFLEQRNAPLITSY Sbjct: 222 LEYTEKERQAIATTAYYDRKET-LPATPDQAAYLPEGYFLEQRNAPLITSY 271 >gb|KKY20956.1| hypothetical protein UCDDS831_g04451 [Diplodia seriata] Length = 277 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/52 (80%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = -3 Query: 381 LEYSEKERQAIATTAYYDRKEAQLQAT-PDQAAYLPEGYFLEQRNAPLITSY 229 +EYSEKERQAIATTAY D KE+QLQ T PDQAA+L E YFLE+RNAPLITSY Sbjct: 226 IEYSEKERQAIATTAYLDGKESQLQTTTPDQAAFLQESYFLERRNAPLITSY 277