BLASTX nr result
ID: Ziziphus21_contig00046419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046419 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12648.1| hypothetical protein MPH_10237 [Macrophomina phas... 64 6e-08 >gb|EKG12648.1| hypothetical protein MPH_10237 [Macrophomina phaseolina MS6] Length = 131 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -1 Query: 138 MHATTVLISLLSLTGFTALASPVPS-AETSANTDNPLVRRTSNCMAQ 1 MHATTVL+SLLSLTGFTALA+PVPS +ETS + N L RRT+ C+A+ Sbjct: 1 MHATTVLVSLLSLTGFTALATPVPSGSETSGDHINALARRTNVCLAE 47