BLASTX nr result
ID: Ziziphus21_contig00046223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046223 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC40571.1| putative antimicrobial knottin protein Btk-3 [Bem... 66 9e-09 >gb|ABC40571.1| putative antimicrobial knottin protein Btk-3 [Bemisia tabaci] Length = 59 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/58 (48%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -2 Query: 301 IMNFYALFLFVVAVITVLTQSVSACLNKGDPCKGDGSMGNCCSGFCFQ-NAGQIGECT 131 + + F + ++++ +VSACL KG CKGDGSMGNCCSGFC+Q N G CT Sbjct: 2 MQKIFVFFFLALVALSMVAVNVSACLTKGASCKGDGSMGNCCSGFCWQANPSSPGSCT 59