BLASTX nr result
ID: Ziziphus21_contig00046190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046190 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014274937.1| PREDICTED: elongation of very long chain fat... 56 9e-06 ref|XP_014260831.1| PREDICTED: elongation of very long chain fat... 56 9e-06 ref|XP_014260829.1| PREDICTED: elongation of very long chain fat... 56 9e-06 ref|XP_013078081.1| PREDICTED: elongation of very long chain fat... 56 9e-06 ref|XP_010728503.1| PREDICTED: elongation of very long chain fat... 56 9e-06 ref|XP_008482253.1| PREDICTED: elongation of very long chain fat... 56 9e-06 >ref|XP_014274937.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Halyomorpha halys] gi|939651814|ref|XP_014274938.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Halyomorpha halys] gi|939651816|ref|XP_014274939.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Halyomorpha halys] gi|939651818|ref|XP_014274941.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Halyomorpha halys] Length = 281 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = -3 Query: 328 KMQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSYIVK 167 K+Q+ QF+ ++ Y LL+ CQ PK LT FQ FL+LF NFY ++Y+ K Sbjct: 216 KLQLAQFIFVLSYCAYLLIKNCQFPKGLTYYAVFQATVFLILFMNFYRKAYLQK 269 >ref|XP_014260831.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform X2 [Cimex lectularius] Length = 249 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = -3 Query: 328 KMQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSY 176 K+Q+ QFV+I++Y++ LL C LP+ LT+ + VTFL+LF NFY +SY Sbjct: 191 KLQLGQFVVILIYLSSLLAFDCNLPRGLTIYMSATTVTFLILFLNFYQKSY 241 >ref|XP_014260829.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform X1 [Cimex lectularius] gi|939280435|ref|XP_014260830.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform X1 [Cimex lectularius] Length = 270 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = -3 Query: 328 KMQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSY 176 K+Q+ QFV+I++Y++ LL C LP+ LT+ + VTFL+LF NFY +SY Sbjct: 212 KLQLGQFVVILIYLSSLLAFDCNLPRGLTIYMSATTVTFLILFLNFYQKSY 262 >ref|XP_013078081.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Biomphalaria glabrata] Length = 286 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = -3 Query: 325 MQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSYI 173 MQMIQF+ + ++ T LL +C PK + F + FL++FANFY+Q+Y+ Sbjct: 209 MQMIQFIAVTIHSTQLLFIECNYPKIFVYWIGFYAIIFLIMFANFYVQAYL 259 >ref|XP_010728503.1| PREDICTED: elongation of very long chain fatty acids protein 4-like [Larimichthys crocea] gi|808869897|gb|KKF19832.1| Elongation of very long chain fatty acids protein 4 [Larimichthys crocea] Length = 263 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/55 (40%), Positives = 38/55 (69%) Frame = -3 Query: 325 MQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSYIVKNK 161 +Q++QF++ +VY LL +C PK++ +++F +T ++LF NFY QSY+ K K Sbjct: 207 LQLVQFLMFLVYTGRNLLTECDFPKSMNLLVFCYCITLVILFGNFYYQSYVNKKK 261 >ref|XP_008482253.1| PREDICTED: elongation of very long chain fatty acids protein 4-like [Diaphorina citri] Length = 130 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -3 Query: 328 KMQMIQFVIIIVYMTGLLLAKCQLPKTLTMMLFFQGVTFLVLFANFYIQSYI 173 ++Q+IQF II+ Y LL+ C LPK L ++ FQ F +LFANFY ++Y+ Sbjct: 26 RLQLIQFAIILSYAVALLVNDCPLPKALNWIMAFQSTVFSLLFANFYYKAYV 77