BLASTX nr result
ID: Ziziphus21_contig00046189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046189 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRL14547.1| Calcium-dependent protease precursor [Nautella i... 57 5e-06 ref|XP_001632927.1| predicted protein [Nematostella vectensis] g... 56 9e-06 >emb|CRL14547.1| Calcium-dependent protease precursor [Nautella italica] Length = 866 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = -1 Query: 223 SDPLYHLQWYLRSCSDLAGDERPSNYDMKIVQAWDEFKVTGQGIIVLVIDDGVYSQHKEL 44 +DPL+ QWYLR+ + P YD+ +V WD++ TG GI + VIDDGV + H +L Sbjct: 5 NDPLFSEQWYLRNAA-------PDQYDLNVVDVWDDY--TGAGITIAVIDDGVEASHPDL 55 Query: 43 KNRIS 29 S Sbjct: 56 AGNYS 60 >ref|XP_001632927.1| predicted protein [Nematostella vectensis] gi|156219990|gb|EDO40864.1| predicted protein, partial [Nematostella vectensis] Length = 553 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/66 (42%), Positives = 43/66 (65%) Frame = -1 Query: 235 PHFYSDPLYHLQWYLRSCSDLAGDERPSNYDMKIVQAWDEFKVTGQGIIVLVIDDGVYSQ 56 P+FY+DP+ QWYL+S + P N DMK++ AW + TG+GI+V V+DDG+ Sbjct: 90 PNFYNDPMLQDQWYLKS---FGRNGVPMNNDMKVMDAWAD-GYTGKGIVVTVMDDGLDHT 145 Query: 55 HKELKN 38 + +LK+ Sbjct: 146 NDDLKH 151