BLASTX nr result
ID: Ziziphus21_contig00046140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046140 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY13411.1| hypothetical protein UCDDS831_g09015 [Diplodia se... 79 2e-12 ref|XP_007589329.1| hypothetical protein UCRNP2_10098 [Neofusico... 66 9e-09 gb|EKG12475.1| hypothetical protein MPH_10432 [Macrophomina phas... 65 2e-08 >gb|KKY13411.1| hypothetical protein UCDDS831_g09015 [Diplodia seriata] Length = 943 Score = 78.6 bits (192), Expect = 2e-12 Identities = 41/77 (53%), Positives = 49/77 (63%) Frame = -1 Query: 363 ELKACAVEIVRKQNDGEDVTAEELQLLDKAQRKFGHIKGSGSFSAPEYXXXXXXXXXXXX 184 ELKA A EIVRK+ +GED+T +E +LL+KAQRKFGHI GSGSFSAPEY Sbjct: 645 ELKARAEEIVRKEKNGEDITEDERELLEKAQRKFGHIAGSGSFSAPEYDSDDSSIMSDDL 704 Query: 183 XXXXXXDRTSPTASPAS 133 R +P +SP S Sbjct: 705 EESTSPQRDAPVSSPPS 721 >ref|XP_007589329.1| hypothetical protein UCRNP2_10098 [Neofusicoccum parvum UCRNP2] gi|485915608|gb|EOD43192.1| hypothetical protein UCRNP2_10098 [Neofusicoccum parvum UCRNP2] Length = 869 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -1 Query: 363 ELKACAVEIVRKQNDGEDVTAEELQLLDKAQRKFGHIKGSGSFSAPEY 220 ELKA A EI +KQ G D+T EE +LLDKA RKFGH+ +GSFS+PEY Sbjct: 628 ELKARAEEIAKKQKSGADITKEEQELLDKALRKFGHVANTGSFSSPEY 675 >gb|EKG12475.1| hypothetical protein MPH_10432 [Macrophomina phaseolina MS6] Length = 918 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -1 Query: 363 ELKACAVEIVRKQNDGEDVTAEELQLLDKAQRKFGHIKGSGSFSAPEY 220 ELK A EIV KQ G T EE QL+DKAQRKFGHI GSGSFS+PEY Sbjct: 680 ELKKRAEEIVAKQKSGIYTTPEEDQLVDKAQRKFGHIAGSGSFSSPEY 727