BLASTX nr result
ID: Ziziphus21_contig00046124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046124 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG15710.1| hypothetical protein MPH_07145 [Macrophomina phas... 69 1e-09 gb|KKY26240.1| hypothetical protein UCDDS831_g01751 [Diplodia se... 64 6e-08 ref|XP_007588803.1| putative duf408 domain protein [Neofusicoccu... 64 6e-08 >gb|EKG15710.1| hypothetical protein MPH_07145 [Macrophomina phaseolina MS6] Length = 219 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -2 Query: 293 ISTPYAPDSAGHMSIEGYEPRMDTKNGIERDEDGDWIL 180 ISTP+ P S+G++SIEGYEPRM++KNGI+RDEDGDWIL Sbjct: 182 ISTPHPPSSSGNLSIEGYEPRMNSKNGIQRDEDGDWIL 219 >gb|KKY26240.1| hypothetical protein UCDDS831_g01751 [Diplodia seriata] Length = 312 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -2 Query: 293 ISTPYAPDSAGHMSIEGYEPRMDTKNGIERDEDGDWIL 180 IS P AP AGHMSIEGYEPR + K+GI RDEDGDWIL Sbjct: 275 ISQPSAPGPAGHMSIEGYEPRTNMKSGIGRDEDGDWIL 312 >ref|XP_007588803.1| putative duf408 domain protein [Neofusicoccum parvum UCRNP2] gi|485916359|gb|EOD43714.1| putative duf408 domain protein [Neofusicoccum parvum UCRNP2] Length = 313 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 293 ISTPYAPDSAGHMSIEGYEPRMDTKNGIERDEDGDWIL 180 IS P P+SA H SIEGY+PRM+ +NG+ERDEDGDWIL Sbjct: 276 ISPPNNPESADHFSIEGYQPRMNGRNGVERDEDGDWIL 313