BLASTX nr result
ID: Ziziphus21_contig00046114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046114 (247 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008470125.1| PREDICTED: OTU domain-containing protein 7B-... 58 3e-06 ref|XP_014281770.1| PREDICTED: OTU domain-containing protein 7B-... 57 5e-06 >ref|XP_008470125.1| PREDICTED: OTU domain-containing protein 7B-like [Diaphorina citri] Length = 548 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 4/50 (8%) Frame = -1 Query: 157 NSTSENKENYRS----EYKTLNRGISRATDNVNIVSRVRSELALVDNTDE 20 +STS + +N + +YK LNRGISRATDN IVSR RSE+ALVDNT+E Sbjct: 35 SSTSSSYQNKLNADIIDYKKLNRGISRATDNEKIVSRARSEIALVDNTEE 84 >ref|XP_014281770.1| PREDICTED: OTU domain-containing protein 7B-like [Halyomorpha halys] gi|939669873|ref|XP_014281771.1| PREDICTED: OTU domain-containing protein 7B-like [Halyomorpha halys] Length = 605 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = -1 Query: 208 AMVNEIVELADSVDDRCNSTSENKENYRSEYKTLNRGISRATDNVNIVSRVRSELALVDN 29 +M + ++ S + S K++ E K LNRGISRATDNVN+VS+ RSE+ +VDN Sbjct: 34 SMTSSPQRISGSSTESFPSPGVKKKHTDFESKKLNRGISRATDNVNLVSQARSEIVIVDN 93 Query: 28 TDEEY 14 D++Y Sbjct: 94 YDQDY 98