BLASTX nr result
ID: Ziziphus21_contig00046036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046036 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16065.1| Peptidase C45 acyl-coenzyme A:6-aminopenicillanic... 78 2e-12 gb|KKY18650.1| putative acyl- :6-aminopenicillanic-acid [Diplodi... 77 7e-12 ref|XP_007586212.1| putative acyl-coenzyme a:6-aminopenicillanic... 75 3e-11 >gb|EKG16065.1| Peptidase C45 acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase [Macrophomina phaseolina MS6] Length = 346 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 332 FPRSINRKQVESNSSETLFNIICDLKAKKAYVTEGRPTEAAGSFEWAL 189 FPR INRK+ E N SETLF IICDL+AKKAYV+EGRPTEA GSFE L Sbjct: 299 FPRGINRKEAEGNHSETLFTIICDLRAKKAYVSEGRPTEAEGSFELEL 346 >gb|KKY18650.1| putative acyl- :6-aminopenicillanic-acid [Diplodia seriata] Length = 336 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -2 Query: 332 FPRSINRKQVESNSSETLFNIICDLKAKKAYVTEGRPTEAAGSF 201 FP S+NRK VE +SETLFNIICDL+A+KAYVTEGRPTEAAG+F Sbjct: 289 FPTSVNRKAVEPRASETLFNIICDLRARKAYVTEGRPTEAAGAF 332 >ref|XP_007586212.1| putative acyl-coenzyme a:6-aminopenicillanic-acid-acyltransferase 40 kda protein [Neofusicoccum parvum UCRNP2] gi|485920216|gb|EOD46303.1| putative acyl-coenzyme a:6-aminopenicillanic-acid-acyltransferase 40 kda protein [Neofusicoccum parvum UCRNP2] Length = 337 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -2 Query: 332 FPRSINRKQVESNSSETLFNIICDLKAKKAYVTEGRPTEAAGSFEW 195 +P+SINR QV+ N SETLFNIICDL+AKKAY+TEGRPT+A +FE+ Sbjct: 290 YPQSINRAQVDGNRSETLFNIICDLRAKKAYITEGRPTKAESNFEF 335