BLASTX nr result
ID: Ziziphus21_contig00045347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045347 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003244558.1| PREDICTED: peroxisomal multifunctional enzym... 61 3e-07 >ref|XP_003244558.1| PREDICTED: peroxisomal multifunctional enzyme type 2 isoform X1 [Acyrthosiphon pisum] gi|328711510|ref|XP_003244559.1| PREDICTED: peroxisomal multifunctional enzyme type 2 isoform X1 [Acyrthosiphon pisum] gi|641664768|ref|XP_008183130.1| PREDICTED: peroxisomal multifunctional enzyme type 2 isoform X1 [Acyrthosiphon pisum] Length = 721 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 290 VGKLNPQVAFVKGKLKIKGNVLLAQKLKSLTAESKL 183 +GKLNPQ+AF+KGKLKIKGN++LAQKLK+L ESKL Sbjct: 686 LGKLNPQMAFMKGKLKIKGNIMLAQKLKALNTESKL 721