BLASTX nr result
ID: Ziziphus21_contig00045313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045313 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18379.1| hypothetical protein MPH_04380 [Macrophomina phas... 59 2e-06 >gb|EKG18379.1| hypothetical protein MPH_04380 [Macrophomina phaseolina MS6] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/56 (57%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -2 Query: 303 PQSGNTXXXXXXXXXXP-GQNLAGITRQVQGPHSMSSPGSNGRFDLSDDFHAKFLW 139 PQS NT P GQ LA T ++QGP SMS SN RFDLSD+FHAKFLW Sbjct: 192 PQSANTPEAPPPTSSQPPGQILAAATHRMQGPQSMSRRASNDRFDLSDEFHAKFLW 247