BLASTX nr result
ID: Ziziphus21_contig00045273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045273 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG17748.1| Ornithine decarboxylase antizyme [Macrophomina ph... 80 5e-13 ref|XP_007588985.1| putative ornithine decarboxylase antizyme pr... 74 4e-11 gb|KKY24215.1| putative ornithine decarboxylase antizyme [Diplod... 72 2e-10 ref|XP_007783173.1| hypothetical protein W97_07353 [Coniosporium... 62 2e-07 >gb|EKG17748.1| Ornithine decarboxylase antizyme [Macrophomina phaseolina MS6] Length = 161 Score = 80.5 bits (197), Expect = 5e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 363 KVLMKDLGWIGFEPITLAEWTETPPIVSEKWVFLGMEV 250 K L+KDLGWIGFEP+TLAEWTETPPIVSEKW+FLGMEV Sbjct: 124 KALIKDLGWIGFEPVTLAEWTETPPIVSEKWIFLGMEV 161 >ref|XP_007588985.1| putative ornithine decarboxylase antizyme protein [Neofusicoccum parvum UCRNP2] gi|485916133|gb|EOD43536.1| putative ornithine decarboxylase antizyme protein [Neofusicoccum parvum UCRNP2] Length = 151 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 363 KVLMKDLGWIGFEPITLAEWTETPPIVSEKWVFLGMEV 250 K LMKDLGWIGFEPITLAEW E PPIVS+ WVFLGMEV Sbjct: 114 KGLMKDLGWIGFEPITLAEWAEKPPIVSDAWVFLGMEV 151 >gb|KKY24215.1| putative ornithine decarboxylase antizyme [Diplodia seriata] Length = 168 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 354 MKDLGWIGFEPITLAEWTETPPIVSEKWVFLGMEV 250 MKDLGWIGFEPITLAEW E PPIVS+ WVFLGMEV Sbjct: 134 MKDLGWIGFEPITLAEWAEKPPIVSDAWVFLGMEV 168 >ref|XP_007783173.1| hypothetical protein W97_07353 [Coniosporium apollinis CBS 100218] gi|494831401|gb|EON67856.1| hypothetical protein W97_07353 [Coniosporium apollinis CBS 100218] Length = 278 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 363 KVLMKDLGWIGFEPITLAEWTETPPIVSEKWVFLGMEV 250 K LM+DLGW+GFE +TLA WT + I+S++WVFLGM+V Sbjct: 241 KALMRDLGWVGFEAVTLARWTHSNEIISDRWVFLGMDV 278