BLASTX nr result
ID: Ziziphus21_contig00045233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045233 (562 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY18480.1| putative protein kinase activator [Diplodia seriata] 86 2e-14 ref|XP_007586454.1| putative protein kinase activator protein [N... 86 2e-14 gb|EKG11318.1| Mob1/phocein [Macrophomina phaseolina MS6] 82 2e-13 ref|XP_007776727.1| hypothetical protein W97_00625 [Coniosporium... 74 6e-11 gb|KIW06747.1| hypothetical protein, variant [Verruconis gallopava] 66 1e-08 gb|KIW06746.1| hypothetical protein PV09_02439 [Verruconis gallo... 66 1e-08 ref|XP_001797239.1| hypothetical protein SNOG_06878 [Parastagono... 66 1e-08 ref|XP_003836108.1| similar to protein kinase activator (Mob2) [... 65 2e-08 ref|XP_007702645.1| hypothetical protein COCSADRAFT_39421 [Bipol... 65 2e-08 gb|KNG51465.1| protein kinase activator [Stemphylium lycopersici] 65 3e-08 ref|XP_007692072.1| hypothetical protein COCMIDRAFT_106229 [Bipo... 65 3e-08 ref|XP_007712790.1| hypothetical protein COCCADRAFT_5501 [Bipola... 65 3e-08 ref|XP_008030151.1| hypothetical protein SETTUDRAFT_43893 [Setos... 65 3e-08 ref|XP_014082752.1| hypothetical protein COCC4DRAFT_129069 [Bipo... 65 3e-08 ref|XP_003306106.1| hypothetical protein PTT_19140 [Pyrenophora ... 65 3e-08 ref|XP_001931218.1| conserved hypothetical protein [Pyrenophora ... 65 3e-08 gb|EME49560.1| hypothetical protein DOTSEDRAFT_122217 [Dothistro... 62 2e-07 gb|KEQ84568.1| Mob1/phocein [Aureobasidium pullulans EXF-150] 60 7e-07 ref|XP_013342819.1| hypothetical protein AUEXF2481DRAFT_30310 [A... 59 1e-06 ref|XP_013428186.1| Mob1/phocein [Aureobasidium namibiae CBS 147... 59 1e-06 >gb|KKY18480.1| putative protein kinase activator [Diplodia seriata] Length = 313 Score = 85.5 bits (210), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEK 434 ELNTCFI+FINVG QYDLLS+KEMEPMMPLIQLWL KGLLPEK Sbjct: 245 ELNTCFIHFINVGQQYDLLSDKEMEPMMPLIQLWLSKGLLPEK 287 >ref|XP_007586454.1| putative protein kinase activator protein [Neofusicoccum parvum UCRNP2] gi|485919923|gb|EOD46102.1| putative protein kinase activator protein [Neofusicoccum parvum UCRNP2] Length = 363 Score = 85.5 bits (210), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEK 434 ELNTCFI+FINVG QYDLLSEKEMEPMMPLIQLWL KGLLP+K Sbjct: 292 ELNTCFIHFINVGQQYDLLSEKEMEPMMPLIQLWLAKGLLPDK 334 >gb|EKG11318.1| Mob1/phocein [Macrophomina phaseolina MS6] Length = 327 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEK 434 ELNTCFI+FINVG Q+DLLSEKEMEPM PLIQLWL KGLLPEK Sbjct: 258 ELNTCFIHFINVGQQFDLLSEKEMEPMGPLIQLWLAKGLLPEK 300 >ref|XP_007776727.1| hypothetical protein W97_00625 [Coniosporium apollinis CBS 100218] gi|494824091|gb|EON61410.1| hypothetical protein W97_00625 [Coniosporium apollinis CBS 100218] Length = 317 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEK 434 ELNTCF++F+NVG Y LL +KEMEPMMPL++LW+GKGLLP + Sbjct: 235 ELNTCFVHFVNVGKLYGLLGDKEMEPMMPLVELWVGKGLLPSQ 277 >gb|KIW06747.1| hypothetical protein, variant [Verruconis gallopava] Length = 287 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLP 440 ELNTCFI+F+NVG + LL +KEMEPM PLI +W KGLLP Sbjct: 221 ELNTCFIHFVNVGKVFGLLGDKEMEPMQPLIDIWTAKGLLP 261 >gb|KIW06746.1| hypothetical protein PV09_02439 [Verruconis gallopava] Length = 345 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLP 440 ELNTCFI+F+NVG + LL +KEMEPM PLI +W KGLLP Sbjct: 279 ELNTCFIHFVNVGKVFGLLGDKEMEPMQPLIDIWTAKGLLP 319 >ref|XP_001797239.1| hypothetical protein SNOG_06878 [Parastagonospora nodorum SN15] gi|160701456|gb|EAT85529.2| hypothetical protein SNOG_06878 [Parastagonospora nodorum SN15] Length = 279 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLP 440 ELNTCFI+FINVG ++LL EKE+EPM PL+ LW KGLLP Sbjct: 224 ELNTCFIHFINVGKLFNLLGEKELEPMQPLVDLWNEKGLLP 264 >ref|XP_003836108.1| similar to protein kinase activator (Mob2) [Leptosphaeria maculans JN3] gi|312212660|emb|CBX92743.1| similar to protein kinase activator (Mob2) [Leptosphaeria maculans JN3] Length = 346 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KG+LP T Sbjct: 284 ELNTCFIHFINVGRLFNLIGDKEIEPMQPLVDLWAEKGMLPSPT 327 >ref|XP_007702645.1| hypothetical protein COCSADRAFT_39421 [Bipolaris sorokiniana ND90Pr] gi|451848413|gb|EMD61719.1| hypothetical protein COCSADRAFT_39421 [Bipolaris sorokiniana ND90Pr] Length = 333 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 280 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPVT 323 >gb|KNG51465.1| protein kinase activator [Stemphylium lycopersici] Length = 344 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 284 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 327 >ref|XP_007692072.1| hypothetical protein COCMIDRAFT_106229 [Bipolaris oryzae ATCC 44560] gi|576927732|gb|EUC41404.1| hypothetical protein COCMIDRAFT_106229 [Bipolaris oryzae ATCC 44560] Length = 333 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 280 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 323 >ref|XP_007712790.1| hypothetical protein COCCADRAFT_5501 [Bipolaris zeicola 26-R-13] gi|953431295|ref|XP_014557719.1| hypothetical protein COCVIDRAFT_36788 [Bipolaris victoriae FI3] gi|576918709|gb|EUC32899.1| hypothetical protein COCCADRAFT_5501 [Bipolaris zeicola 26-R-13] gi|578490701|gb|EUN28114.1| hypothetical protein COCVIDRAFT_36788 [Bipolaris victoriae FI3] Length = 333 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 280 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 323 >ref|XP_008030151.1| hypothetical protein SETTUDRAFT_43893 [Setosphaeria turcica Et28A] gi|482804816|gb|EOA81915.1| hypothetical protein SETTUDRAFT_43893 [Setosphaeria turcica Et28A] Length = 345 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 282 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 325 >ref|XP_014082752.1| hypothetical protein COCC4DRAFT_129069 [Bipolaris maydis ATCC 48331] gi|451998937|gb|EMD91400.1| hypothetical protein COCHEDRAFT_1102476 [Bipolaris maydis C5] gi|477591771|gb|ENI08843.1| hypothetical protein COCC4DRAFT_129069 [Bipolaris maydis ATCC 48331] Length = 276 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 223 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 266 >ref|XP_003306106.1| hypothetical protein PTT_19140 [Pyrenophora teres f. teres 0-1] gi|311316546|gb|EFQ85783.1| hypothetical protein PTT_19140 [Pyrenophora teres f. teres 0-1] Length = 291 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 221 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 264 >ref|XP_001931218.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972824|gb|EDU40323.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 347 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPEKT 431 ELNTCFI+FINVG ++L+ +KE+EPM PL+ LW KGLLP T Sbjct: 280 ELNTCFIHFINVGKLFNLIGDKEIEPMQPLVDLWAEKGLLPPIT 323 >gb|EME49560.1| hypothetical protein DOTSEDRAFT_122217 [Dothistroma septosporum NZE10] Length = 285 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKGLLPE 437 +LNTCFI+FINVG + LL +KE+EPM PLI+LW+ +G LP+ Sbjct: 203 DLNTCFIHFINVGRIFGLLPDKEIEPMQPLIELWIARGDLPK 244 >gb|KEQ84568.1| Mob1/phocein [Aureobasidium pullulans EXF-150] Length = 337 Score = 60.1 bits (144), Expect = 7e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKG 449 ELNTCFI+F+NVG ++LL +KE+EPM PL+ +WL KG Sbjct: 259 ELNTCFIHFVNVGRLFNLLGDKELEPMAPLLDIWLEKG 296 >ref|XP_013342819.1| hypothetical protein AUEXF2481DRAFT_30310 [Aureobasidium subglaciale EXF-2481] gi|662537022|gb|KEQ94332.1| hypothetical protein AUEXF2481DRAFT_30310 [Aureobasidium subglaciale EXF-2481] Length = 337 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKG 449 ELNTCFI+F+NVG + LL +KE+EPM PL+ +WL KG Sbjct: 268 ELNTCFIHFVNVGRLFGLLGDKELEPMAPLLDIWLEKG 305 >ref|XP_013428186.1| Mob1/phocein [Aureobasidium namibiae CBS 147.97] gi|662516197|gb|KEQ73761.1| Mob1/phocein [Aureobasidium namibiae CBS 147.97] Length = 320 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 562 ELNTCFINFINVGHQYDLLSEKEMEPMMPLIQLWLGKG 449 ELNTCFI+F+NVG + LL +KE+EPM PL+ +WL KG Sbjct: 250 ELNTCFIHFVNVGRLFGLLGDKELEPMAPLLDIWLEKG 287