BLASTX nr result
ID: Ziziphus21_contig00045194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045194 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY26031.1| putative arp2 3 complex 34 kda subunit [Diplodia ... 67 5e-09 ref|XP_007584549.1| putative arp2 3 complex 34 kda subunit prote... 67 5e-09 gb|EKG22075.1| Arp2/3 complex 34kDa subunit p34-Arc [Macrophomin... 67 5e-09 gb|KJX92610.1| arp2 3 complex 34 kda subunit like protein [Zymos... 61 3e-07 gb|EMF10734.1| ARP2/3 complex 34 kDa subunit [Sphaerulina musiva... 61 3e-07 gb|EME38459.1| hypothetical protein DOTSEDRAFT_75851 [Dothistrom... 61 3e-07 ref|XP_003852510.1| hypothetical protein MYCGRDRAFT_72463 [Zymos... 61 3e-07 gb|KIN04727.1| hypothetical protein OIDMADRAFT_17662 [Oidiodendr... 60 5e-07 gb|KFZ14959.1| hypothetical protein V501_02947 [Pseudogymnoascus... 60 5e-07 gb|KFY88714.1| hypothetical protein V500_06167 [Pseudogymnoascus... 60 5e-07 gb|KFY84322.1| hypothetical protein V498_07851 [Pseudogymnoascus... 60 5e-07 gb|KFY74246.1| hypothetical protein V499_05702 [Pseudogymnoascus... 60 5e-07 gb|KFY49310.1| hypothetical protein V496_10130 [Pseudogymnoascus... 60 5e-07 gb|KFY40683.1| hypothetical protein V494_03378 [Pseudogymnoascus... 60 5e-07 gb|KFY28897.1| hypothetical protein V493_02694 [Pseudogymnoascus... 60 5e-07 gb|KFY26854.1| hypothetical protein V491_01144 [Pseudogymnoascus... 60 5e-07 gb|KFX88402.1| hypothetical protein V490_07655 [Pseudogymnoascus... 60 5e-07 ref|XP_007828787.1| hypothetical protein PFICI_02015 [Pestalotio... 60 5e-07 gb|ESZ95435.1| ARP2/3 actin-organizing complex subunit Arc34 [Sc... 60 5e-07 ref|XP_012744429.1| hypothetical protein GMDG_05993 [Pseudogymno... 60 5e-07 >gb|KKY26031.1| putative arp2 3 complex 34 kda subunit [Diplodia seriata] Length = 318 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKVNF 103 RRTAD LQVLRRARPETEEKERKTASGRTFKVNF Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFKVNF 318 >ref|XP_007584549.1| putative arp2 3 complex 34 kda subunit protein [Neofusicoccum parvum UCRNP2] gi|485922550|gb|EOD47972.1| putative arp2 3 complex 34 kda subunit protein [Neofusicoccum parvum UCRNP2] Length = 318 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKVNF 103 RRTAD LQVLRRARPETEEKERKTASGRTFKVNF Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFKVNF 318 >gb|EKG22075.1| Arp2/3 complex 34kDa subunit p34-Arc [Macrophomina phaseolina MS6] Length = 318 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKVNF 103 RRTAD LQVLRRARPETEEKERKTASGRTFKVNF Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFKVNF 318 >gb|KJX92610.1| arp2 3 complex 34 kda subunit like protein [Zymoseptoria brevis] Length = 318 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPETEEKERKTASGRTF+V Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFRV 316 >gb|EMF10734.1| ARP2/3 complex 34 kDa subunit [Sphaerulina musiva SO2202] Length = 318 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARP+TEEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPDTEEKERKTASGRTFKV 316 >gb|EME38459.1| hypothetical protein DOTSEDRAFT_75851 [Dothistroma septosporum NZE10] Length = 318 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPETEEKERKTASGRTF+V Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFRV 316 >ref|XP_003852510.1| hypothetical protein MYCGRDRAFT_72463 [Zymoseptoria tritici IPO323] gi|339472391|gb|EGP87486.1| hypothetical protein MYCGRDRAFT_72463 [Zymoseptoria tritici IPO323] Length = 318 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPETEEKERKTASGRTF+V Sbjct: 285 RRTADFLQVLRRARPETEEKERKTASGRTFRV 316 >gb|KIN04727.1| hypothetical protein OIDMADRAFT_17662 [Oidiodendron maius Zn] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFZ14959.1| hypothetical protein V501_02947 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 335 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 301 RRTADFLQVLRRARPENEEKERKTASGRTFKV 332 >gb|KFY88714.1| hypothetical protein V500_06167 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682451386|gb|KFZ10759.1| hypothetical protein V502_07948 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFY84322.1| hypothetical protein V498_07851 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFY74246.1| hypothetical protein V499_05702 [Pseudogymnoascus pannorum VKM F-103] Length = 335 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 301 RRTADFLQVLRRARPENEEKERKTASGRTFKV 332 >gb|KFY49310.1| hypothetical protein V496_10130 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFY40683.1| hypothetical protein V494_03378 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFY28897.1| hypothetical protein V493_02694 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFY26854.1| hypothetical protein V491_01144 [Pseudogymnoascus pannorum VKM F-3775] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >gb|KFX88402.1| hypothetical protein V490_07655 [Pseudogymnoascus pannorum VKM F-3557] gi|682279609|gb|KFY01118.1| hypothetical protein O988_02903 [Pseudogymnoascus pannorum VKM F-3808] gi|682352445|gb|KFY43439.1| hypothetical protein V495_03936 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682373967|gb|KFY58756.1| hypothetical protein V497_04676 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >ref|XP_007828787.1| hypothetical protein PFICI_02015 [Pestalotiopsis fici W106-1] gi|573068659|gb|ETS88187.1| hypothetical protein PFICI_02015 [Pestalotiopsis fici W106-1] Length = 201 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 167 RRTADFLQVLRRARPENEEKERKTASGRTFKV 198 >gb|ESZ95435.1| ARP2/3 actin-organizing complex subunit Arc34 [Sclerotinia borealis F-4157] Length = 318 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316 >ref|XP_012744429.1| hypothetical protein GMDG_05993 [Pseudogymnoascus destructans 20631-21] gi|440633248|gb|ELR03167.1| hypothetical protein GMDG_05993 [Pseudogymnoascus destructans 20631-21] Length = 319 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 RRTADCLQVLRRARPETEEKERKTASGRTFKV 97 RRTAD LQVLRRARPE EEKERKTASGRTFKV Sbjct: 285 RRTADFLQVLRRARPENEEKERKTASGRTFKV 316