BLASTX nr result
ID: Ziziphus21_contig00045181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045181 (513 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10899.1| Mitochondrial inner membrane translocase complex ... 57 4e-06 >gb|EKG10899.1| Mitochondrial inner membrane translocase complex subunit Tim17/22 [Macrophomina phaseolina MS6] Length = 223 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 511 TRGLKPMAISSGLVAAAAGCWAMIRKVMFE 422 TRGLKPMAISSGLVAAAAG WAMIRK++FE Sbjct: 194 TRGLKPMAISSGLVAAAAGSWAMIRKIVFE 223