BLASTX nr result
ID: Ziziphus21_contig00045113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045113 (445 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007584692.1| putative mitochondrial folate carrier protei... 82 2e-13 gb|EKG15917.1| Mitochondrial substrate/solute carrier [Macrophom... 80 6e-13 ref|XP_007781942.1| hypothetical protein W97_05871 [Coniosporium... 62 1e-07 gb|EME43346.1| hypothetical protein DOTSEDRAFT_89244 [Dothistrom... 60 5e-07 ref|XP_007927621.1| hypothetical protein MYCFIDRAFT_83540 [Pseud... 59 1e-06 gb|KIW09206.1| hypothetical protein PV09_00134 [Verruconis gallo... 58 2e-06 gb|KJX98436.1| mitochondrial folate carrier protein Flx1 [Zymose... 58 3e-06 ref|XP_003850487.1| hypothetical protein MYCGRDRAFT_74485 [Zymos... 58 3e-06 gb|KEQ80295.1| mitochondrial carrier [Aureobasidium pullulans EX... 56 9e-06 gb|KEQ61819.1| mitochondrial carrier [Aureobasidium melanogenum ... 56 9e-06 >ref|XP_007584692.1| putative mitochondrial folate carrier protein [Neofusicoccum parvum UCRNP2] gi|485922303|gb|EOD47846.1| putative mitochondrial folate carrier protein [Neofusicoccum parvum UCRNP2] Length = 317 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEGDHEMD 328 LLPNVVRVLPTTCVTFLVYE+TKFYLPRIWDPE DHE D Sbjct: 279 LLPNVVRVLPTTCVTFLVYENTKFYLPRIWDPEADHETD 317 >gb|EKG15917.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 316 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEGDHEMD 328 LLPNVVRVLPTTCVTFLVYE+T+FYLPRIW PEGDHE D Sbjct: 278 LLPNVVRVLPTTCVTFLVYENTRFYLPRIWHPEGDHETD 316 >ref|XP_007781942.1| hypothetical protein W97_05871 [Coniosporium apollinis CBS 100218] gi|494830056|gb|EON66625.1| hypothetical protein W97_05871 [Coniosporium apollinis CBS 100218] Length = 322 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 438 PNVVRVLPTTCVTFLVYEDTKFYLPRIWD 352 PN+VRVLP+TCVTFLVYE+TKFYLPR+WD Sbjct: 286 PNIVRVLPSTCVTFLVYENTKFYLPRVWD 314 >gb|EME43346.1| hypothetical protein DOTSEDRAFT_89244 [Dothistroma septosporum NZE10] Length = 341 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEG 343 L PN++RVLP+TCVTFLVYE+ KFYLPR+W EG Sbjct: 304 LAPNLIRVLPSTCVTFLVYENMKFYLPRMWHSEG 337 >ref|XP_007927621.1| hypothetical protein MYCFIDRAFT_83540 [Pseudocercospora fijiensis CIRAD86] gi|452982452|gb|EME82211.1| hypothetical protein MYCFIDRAFT_83540 [Pseudocercospora fijiensis CIRAD86] Length = 313 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEG 343 L PN+VRVLP+TCVTFLVYE+ K+YLPR W EG Sbjct: 276 LAPNIVRVLPSTCVTFLVYENMKYYLPRFWAGEG 309 >gb|KIW09206.1| hypothetical protein PV09_00134 [Verruconis gallopava] Length = 315 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/31 (74%), Positives = 31/31 (100%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWD 352 LLPN++RVLP+TCVTFLVYE+TK+YLPR+++ Sbjct: 277 LLPNIIRVLPSTCVTFLVYENTKYYLPRLYN 307 >gb|KJX98436.1| mitochondrial folate carrier protein Flx1 [Zymoseptoria brevis] Length = 344 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEGD 340 L PN+VRV+P+TCVTFLVYE+ KFYLPR+W D Sbjct: 303 LAPNLVRVVPSTCVTFLVYENVKFYLPRVWHDAKD 337 >ref|XP_003850487.1| hypothetical protein MYCGRDRAFT_74485 [Zymoseptoria tritici IPO323] gi|339470365|gb|EGP85463.1| hypothetical protein MYCGRDRAFT_74485 [Zymoseptoria tritici IPO323] Length = 326 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 444 LLPNVVRVLPTTCVTFLVYEDTKFYLPRIWDPEGD 340 L PN+VRV+P+TCVTFLVYE+ KFYLPR+W D Sbjct: 285 LAPNLVRVVPSTCVTFLVYENVKFYLPRVWHDAKD 319 >gb|KEQ80295.1| mitochondrial carrier [Aureobasidium pullulans EXF-150] Length = 335 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -2 Query: 438 PNVVRVLPTTCVTFLVYEDTKFYLPRIWD 352 PN+VRVLP+TCVTFLVYE+TKFYLPR ++ Sbjct: 298 PNIVRVLPSTCVTFLVYENTKFYLPRFYE 326 >gb|KEQ61819.1| mitochondrial carrier [Aureobasidium melanogenum CBS 110374] Length = 316 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 438 PNVVRVLPTTCVTFLVYEDTKFYLPRIW 355 PN+VRVLP+TCVTFLVYE+TKFYLPR++ Sbjct: 279 PNIVRVLPSTCVTFLVYENTKFYLPRLY 306