BLASTX nr result
ID: Ziziphus21_contig00045067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045067 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001949774.2| PREDICTED: 26S proteasome non-ATPase regulat... 57 7e-06 >ref|XP_001949774.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1 [Acyrthosiphon pisum] Length = 979 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 96 PNFEILSNPARVMNQQLKHLQLVDENAYKPLK 1 PNFEIL+NPAR+M QQLKHLQLV+ ++Y+PLK Sbjct: 898 PNFEILNNPARIMKQQLKHLQLVENSSYQPLK 929