BLASTX nr result
ID: Ziziphus21_contig00045064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045064 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAN21113.1| leucine-rich transmembrane protein [Riptortus pe... 60 6e-07 ref|XP_014280676.1| PREDICTED: insulin-like growth factor-bindin... 58 2e-06 >dbj|BAN21113.1| leucine-rich transmembrane protein [Riptortus pedestris] Length = 694 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/93 (30%), Positives = 57/93 (61%), Gaps = 7/93 (7%) Frame = -1 Query: 289 LLSRLSFLDISNNSISNLQVYDFHTMDALETIDLAGNPIMCVSPTIQLIEYFIKKEVDPH 110 +LS+L +L++S N ++ L + F ++ L+ +D++ NPI C ++++ I K+V+P+ Sbjct: 471 ILSKLVYLNVSGNKLTKLHTHYFISLQNLQKLDISNNPIECTPDFSHVMQWLIMKKVEPN 530 Query: 109 RKSEK-------LLENGKPDKVKWNDIITGLCP 32 + + + L+EN VKW++I+ G+CP Sbjct: 531 KVTTERTIYGLDLIEN----NVKWDEILRGVCP 559 >ref|XP_014280676.1| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit [Halyomorpha halys] gi|939667094|ref|XP_014280677.1| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit [Halyomorpha halys] gi|939667096|ref|XP_014280678.1| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit [Halyomorpha halys] Length = 693 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/95 (31%), Positives = 57/95 (60%), Gaps = 6/95 (6%) Frame = -1 Query: 295 HKLLSRLSFLDISNNSISNLQVYDFHTMDALETIDLAGNPIMCVSPTIQLIEYFIKKEVD 116 H +LSRL++L++S N ++ L + F +M L+ +D++ NPI C ++++ I K V Sbjct: 470 HNILSRLTYLNLSGNKLTKLHKHYFVSMIKLKKLDISNNPIECTPDFSHVMQWLIIKRVM 529 Query: 115 PHRKSEK------LLENGKPDKVKWNDIITGLCPV 29 P++ + + L+EN V+W+DI+ +CP+ Sbjct: 530 PNKGTTESPANLDLIEN----NVQWDDILKIVCPL 560