BLASTX nr result
ID: Ziziphus21_contig00044979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044979 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG11891.1| Cytochrome c oxidase biogenesis protein Cmc1-like... 122 1e-25 ref|XP_007586901.1| putative cytochrome c oxidase biogenesis pro... 120 4e-25 gb|KKY16960.1| putative cytochrome c oxidase biogenesis protein ... 115 1e-23 gb|KEQ65223.1| UPF0287-domain-containing protein [Aureobasidium ... 103 5e-20 gb|KEQ82314.1| UPF0287-domain-containing protein [Aureobasidium ... 102 1e-19 ref|XP_007828844.1| hypothetical protein PFICI_02072 [Pestalotio... 101 2e-19 ref|XP_013347227.1| hypothetical protein AUEXF2481DRAFT_1905 [Au... 100 4e-19 ref|XP_013431438.1| UPF0287-domain-containing protein [Aureobasi... 99 1e-18 gb|KJX92760.1| cytochrome C oxidase biogenesis Cmc1-like protein... 99 1e-18 dbj|GAM85821.1| hypothetical protein ANO11243_038290 [fungal sp.... 99 1e-18 ref|XP_007290343.1| cmc1-like, cytochrome c oxidase biogenesis p... 99 1e-18 ref|XP_001794861.1| hypothetical protein SNOG_04443 [Parastagono... 98 3e-18 ref|XP_007799206.1| putative cytochrome c oxidase biogenesis pro... 97 6e-18 ref|XP_007677929.1| hypothetical protein BAUCODRAFT_123919 [Baud... 96 1e-17 gb|KFY84502.1| hypothetical protein V500_09295 [Pseudogymnoascus... 95 2e-17 gb|EME44153.1| hypothetical protein DOTSEDRAFT_44423 [Dothistrom... 95 2e-17 emb|CCU76134.1| hypothetical protein BGHDH14_bgh01721 [Blumeria ... 95 2e-17 gb|KFY59332.1| hypothetical protein V496_05701 [Pseudogymnoascus... 93 9e-17 emb|CCD45470.1| hypothetical protein BofuT4_uP044880.1 [Botrytis... 93 9e-17 ref|XP_001594611.1| hypothetical protein SS1G_04418 [Sclerotinia... 93 9e-17 >gb|EKG11891.1| Cytochrome c oxidase biogenesis protein Cmc1-like protein [Macrophomina phaseolina MS6] Length = 80 Score = 122 bits (305), Expect = 1e-25 Identities = 59/64 (92%), Positives = 59/64 (92%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFLYKAVGMCNK KHAVNMCLRAQRLERT NREQAKVKREKIEKVWAEI Sbjct: 17 MNALEECHARGFLYKAVGMCNKPKHAVNMCLRAQRLERTKANREQAKVKREKIEKVWAEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >ref|XP_007586901.1| putative cytochrome c oxidase biogenesis protein cmc1-like protein [Neofusicoccum parvum UCRNP2] gi|485919269|gb|EOD45653.1| putative cytochrome c oxidase biogenesis protein cmc1-like protein [Neofusicoccum parvum UCRNP2] Length = 70 Score = 120 bits (301), Expect = 4e-25 Identities = 58/64 (90%), Positives = 59/64 (92%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFLYKAVGMCNK KHAVNMCLRAQRLERT NREQAKVKRE+IEKVWAEI Sbjct: 7 MNALEECHARGFLYKAVGMCNKPKHAVNMCLRAQRLERTKANREQAKVKREQIEKVWAEI 66 Query: 128 DANS 117 DANS Sbjct: 67 DANS 70 >gb|KKY16960.1| putative cytochrome c oxidase biogenesis protein cmc1-like protein [Diplodia seriata] Length = 80 Score = 115 bits (289), Expect = 1e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M AL+EC +RGFLYKAVGMCNK KHAVNMCLRAQRLERT NREQAK+KREKI++VWAEI Sbjct: 17 MNALDECHSRGFLYKAVGMCNKPKHAVNMCLRAQRLERTKANREQAKIKREKIDRVWAEI 76 Query: 128 DANS 117 DAN+ Sbjct: 77 DANT 80 >gb|KEQ65223.1| UPF0287-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 80 Score = 103 bits (257), Expect = 5e-20 Identities = 49/64 (76%), Positives = 54/64 (84%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFL+K++GMC K KH VNMCLRA+RLERT +NRE AK KR KIE VWAEI Sbjct: 17 MNALEECHARGFLWKSMGMCTKAKHQVNMCLRAERLERTRLNREVAKEKRAKIESVWAEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >gb|KEQ82314.1| UPF0287-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 80 Score = 102 bits (254), Expect = 1e-19 Identities = 49/64 (76%), Positives = 53/64 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFL+K++GMC K KH VNMCLRA+RLERT NRE AK KR KIE VWAEI Sbjct: 17 MNALEECHARGFLWKSMGMCTKAKHQVNMCLRAERLERTRQNREVAKEKRAKIESVWAEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >ref|XP_007828844.1| hypothetical protein PFICI_02072 [Pestalotiopsis fici W106-1] gi|573068716|gb|ETS88244.1| hypothetical protein PFICI_02072 [Pestalotiopsis fici W106-1] Length = 92 Score = 101 bits (252), Expect = 2e-19 Identities = 47/64 (73%), Positives = 56/64 (87%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MTALEEC ARGFL+K++GMC+ K VNMCLRA+RL+RTA NRE AKVKR+KI+KVWAEI Sbjct: 29 MTALEECHARGFLWKSLGMCSDAKQQVNMCLRAERLKRTAANREAAKVKRDKIKKVWAEI 88 Query: 128 DANS 117 D N+ Sbjct: 89 DENT 92 >ref|XP_013347227.1| hypothetical protein AUEXF2481DRAFT_1905 [Aureobasidium subglaciale EXF-2481] gi|662541789|gb|KEQ99088.1| hypothetical protein AUEXF2481DRAFT_1905 [Aureobasidium subglaciale EXF-2481] Length = 80 Score = 100 bits (249), Expect = 4e-19 Identities = 47/64 (73%), Positives = 52/64 (81%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFL+K++GMC K KH VNMCLR +RLERT NRE AK KR K+E VWAEI Sbjct: 17 MNALEECHARGFLWKSMGMCTKAKHQVNMCLRVERLERTRQNREVAKEKRAKVESVWAEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >ref|XP_013431438.1| UPF0287-domain-containing protein [Aureobasidium namibiae CBS 147.97] gi|662519583|gb|KEQ77142.1| UPF0287-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 80 Score = 99.4 bits (246), Expect = 1e-18 Identities = 47/64 (73%), Positives = 52/64 (81%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC ARGFL+K++GMC K KH VNMCLRA+RLERT NRE AK KR K E VWA+I Sbjct: 17 MNALEECHARGFLWKSMGMCTKAKHQVNMCLRAERLERTRQNREVAKEKRAKYESVWADI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >gb|KJX92760.1| cytochrome C oxidase biogenesis Cmc1-like protein [Zymoseptoria brevis] Length = 80 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC A+GF++KA+GMC+ K+ VN CLRA+RLERTAVNRE+AK KRE ++KVWAEI Sbjct: 17 MNALEECHAKGFMWKAIGMCSATKNEVNKCLRAERLERTAVNREEAKKKREHMKKVWAEI 76 Query: 128 DANS 117 +ANS Sbjct: 77 EANS 80 >dbj|GAM85821.1| hypothetical protein ANO11243_038290 [fungal sp. No.11243] Length = 64 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/64 (70%), Positives = 52/64 (81%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MTALEEC ARGF++K++GMC + KHAVNMCLRA+RLERT NRE AK KR K+E W EI Sbjct: 1 MTALEECHARGFIWKSMGMCTEAKHAVNMCLRAERLERTRANRENAKEKRRKMEAAWREI 60 Query: 128 DANS 117 D NS Sbjct: 61 DENS 64 >ref|XP_007290343.1| cmc1-like, cytochrome c oxidase biogenesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866177|gb|EKD19217.1| cmc1-like, cytochrome c oxidase biogenesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 80 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MTALEEC ARGFL+KAVGMCN K VN CLRAQRLERT +NRE+A+VK E+I WAEI Sbjct: 17 MTALEECHARGFLWKAVGMCNGAKTQVNKCLRAQRLERTRLNREKARVKNEEIRAKWAEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >ref|XP_001794861.1| hypothetical protein SNOG_04443 [Parastagonospora nodorum SN15] gi|111067083|gb|EAT88203.1| hypothetical protein SNOG_04443 [Parastagonospora nodorum SN15] Length = 78 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/63 (73%), Positives = 52/63 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 + AL+EC ARGFL+K G C + K+ VNMCLRAQRLERT VNRE AK KREKIEKVWAE+ Sbjct: 15 VAALDECHARGFLWKVTGNCTEAKYKVNMCLRAQRLERTRVNREVAKEKREKIEKVWAEL 74 Query: 128 DAN 120 DAN Sbjct: 75 DAN 77 >ref|XP_007799206.1| putative cytochrome c oxidase biogenesis protein cmc1-like protein [Eutypa lata UCREL1] gi|471559243|gb|EMR61689.1| putative cytochrome c oxidase biogenesis protein cmc1-like protein [Eutypa lata UCREL1] Length = 80 Score = 96.7 bits (239), Expect = 6e-18 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MTALEEC ARGFL+K++GMCN K V +CLRA+RL+RTA NRE AK KR+KI K W+EI Sbjct: 17 MTALEECHARGFLWKSLGMCNNAKDQVTLCLRAERLKRTARNREAAKAKRDKIVKAWSEI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >ref|XP_007677929.1| hypothetical protein BAUCODRAFT_123919 [Baudoinia panamericana UAMH 10762] gi|449299472|gb|EMC95486.1| hypothetical protein BAUCODRAFT_123919 [Baudoinia panamericana UAMH 10762] Length = 80 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MTALEEC A+GFL+KA GMC+ K VN CLRA+RL+RTA NREQA+ KR K+E VWAEI Sbjct: 17 MTALEECHAKGFLWKAAGMCSDIKRDVNKCLRAERLDRTAKNREQAREKRAKVEAVWAEI 76 Query: 128 DANS 117 +ANS Sbjct: 77 EANS 80 >gb|KFY84502.1| hypothetical protein V500_09295 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682463428|gb|KFZ18822.1| hypothetical protein V502_03972 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 80 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/64 (67%), Positives = 53/64 (82%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 MT L+EC ARGFLYKAVGMCN K V +CLRAQR+ERTA NRE+A++KRE+I+ +WA+I Sbjct: 17 MTMLDECHARGFLYKAVGMCNGVKRDVTLCLRAQRVERTAANREKARIKREQIKAIWAKI 76 Query: 128 DANS 117 D S Sbjct: 77 DEES 80 >gb|EME44153.1| hypothetical protein DOTSEDRAFT_44423 [Dothistroma septosporum NZE10] Length = 80 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/64 (67%), Positives = 54/64 (84%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M ALEEC A+GF++KA+GMC+++K +NMCLR RLERTA NRE+AK KRE ++KVWAEI Sbjct: 17 MIALEECHAKGFMWKAMGMCSEKKQEMNMCLRRARLERTAANREEAKKKREHMKKVWAEI 76 Query: 128 DANS 117 D NS Sbjct: 77 DENS 80 >emb|CCU76134.1| hypothetical protein BGHDH14_bgh01721 [Blumeria graminis f. sp. hordei DH14] Length = 80 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/64 (68%), Positives = 51/64 (79%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M AL+EC ARGFL+KAVGMCN K AVN CLR QRLERT NRE AK K ++I ++WA+I Sbjct: 17 MNALDECHARGFLWKAVGMCNDAKTAVNKCLREQRLERTKANREAAKAKNKEIREIWADI 76 Query: 128 DANS 117 DANS Sbjct: 77 DANS 80 >gb|KFY59332.1| hypothetical protein V496_05701 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682430327|gb|KFY96448.1| hypothetical protein V498_02681 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 80 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M L+EC +RGFLYKAVGMCN K V +CLRAQR+ERTA NRE+AK+KRE+I+ +WA+I Sbjct: 17 MNMLDECHSRGFLYKAVGMCNGVKRDVTVCLRAQRVERTAANREKAKIKREQIKAIWAKI 76 Query: 128 DANS 117 D S Sbjct: 77 DEES 80 >emb|CCD45470.1| hypothetical protein BofuT4_uP044880.1 [Botrytis cinerea T4] Length = 81 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M AL+EC ARGFL+K +GMCN +K AVN CLRAQRL RTA NRE AKVK EKI+ WAEI Sbjct: 18 MAALDECHARGFLWKCMGMCNDKKTAVNKCLRAQRLARTAANREAAKVKNEKIKAKWAEI 77 Query: 128 DANS 117 D S Sbjct: 78 DEAS 81 >ref|XP_001594611.1| hypothetical protein SS1G_04418 [Sclerotinia sclerotiorum 1980] gi|154702204|gb|EDO01943.1| hypothetical protein SS1G_04418 [Sclerotinia sclerotiorum 1980 UF-70] Length = 81 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = -3 Query: 308 MTALEECRARGFLYKAVGMCNKQKHAVNMCLRAQRLERTAVNREQAKVKREKIEKVWAEI 129 M AL+EC ARGFL+K +GMCN +K AVN CLRAQRL RTA NRE AKVK EKI+ WAEI Sbjct: 18 MAALDECHARGFLWKCMGMCNDKKTAVNKCLRAQRLARTAANREAAKVKNEKIKAKWAEI 77 Query: 128 DANS 117 D S Sbjct: 78 DEAS 81