BLASTX nr result
ID: Ziziphus21_contig00044951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044951 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18393.1| hypothetical protein MPH_04394 [Macrophomina phas... 84 4e-14 gb|KKY16459.1| putative mms4 protein [Diplodia seriata] 74 4e-11 ref|XP_007589493.1| putative srp40-c-like protein [Neofusicoccum... 69 1e-09 >gb|EKG18393.1| hypothetical protein MPH_04394 [Macrophomina phaseolina MS6] Length = 382 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 143 PANKRKRDASATDTPSNEDSGTSTPSGDNGNKRAKKSNEPFSRIPKN 3 PANKRKRDAS TDTPSN SG STPSGD GNKRAKK+NEPFSRIPK+ Sbjct: 274 PANKRKRDASGTDTPSNPVSGMSTPSGDAGNKRAKKTNEPFSRIPKD 320 >gb|KKY16459.1| putative mms4 protein [Diplodia seriata] Length = 404 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 143 PANKRKRDASATDTPSNEDSGTSTPSGDNGNKRAKKSNEPFSRIP 9 P +KRKR+ SA DTPSN SGTSTPSG++GNKRAKKSN PFSRIP Sbjct: 296 PGSKRKRNDSAADTPSNAVSGTSTPSGEDGNKRAKKSNVPFSRIP 340 >ref|XP_007589493.1| putative srp40-c-like protein [Neofusicoccum parvum UCRNP2] gi|485915348|gb|EOD43028.1| putative srp40-c-like protein [Neofusicoccum parvum UCRNP2] Length = 406 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -3 Query: 143 PANKRKRDASATDTPSNEDSGTSTPSGDNGNKRAKKSNEPFSRIPKN 3 P+NKRKRDASA DTPSN SG T NGNKRA K+NEPFSRIPK+ Sbjct: 299 PSNKRKRDASAADTPSNTTSGADTSDNGNGNKRA-KTNEPFSRIPKD 344