BLASTX nr result
ID: Ziziphus21_contig00044628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044628 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20496.1| Ribosomal protein L4/L1e [Macrophomina phaseolina... 86 1e-14 ref|XP_007585778.1| putative 50s ribosomal protein l4 protein [N... 80 6e-13 gb|KKY27794.1| putative 50s ribosomal protein l4 [Diplodia seriata] 78 3e-12 >gb|EKG20496.1| Ribosomal protein L4/L1e [Macrophomina phaseolina MS6] Length = 271 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 122 NLYSPPIPEHIRPSTVHTTIYRFPTMEPLRFETYPSAHLL 3 NLY+PPIPEHIRPSTVHTTIYRFPTMEPLRF TYPSAHLL Sbjct: 32 NLYAPPIPEHIRPSTVHTTIYRFPTMEPLRFATYPSAHLL 71 >ref|XP_007585778.1| putative 50s ribosomal protein l4 protein [Neofusicoccum parvum UCRNP2] gi|485920866|gb|EOD46751.1| putative 50s ribosomal protein l4 protein [Neofusicoccum parvum UCRNP2] Length = 269 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 LYSPPIPEHIRPSTVHTTIYRFPTMEPLRFETYPSAHLL 3 LYSPPIPEHIRPSTVHTTIY+FPTMEPLRF YPS+HLL Sbjct: 31 LYSPPIPEHIRPSTVHTTIYQFPTMEPLRFAAYPSSHLL 69 >gb|KKY27794.1| putative 50s ribosomal protein l4 [Diplodia seriata] Length = 282 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 122 NLYSPPIPEHIRPSTVHTTIYRFPTMEPLRFETYPSAHLL 3 NLYSPPIPEHIRP TV TTIYRFPTMEPLRF YPS+HLL Sbjct: 42 NLYSPPIPEHIRPPTVPTTIYRFPTMEPLRFVAYPSSHLL 81