BLASTX nr result
ID: Ziziphus21_contig00044615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044615 (248 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21133.1| hypothetical protein MPH_01552 [Macrophomina phas... 79 1e-12 >gb|EKG21133.1| hypothetical protein MPH_01552 [Macrophomina phaseolina MS6] Length = 289 Score = 79.3 bits (194), Expect = 1e-12 Identities = 38/44 (86%), Positives = 44/44 (100%) Frame = -3 Query: 204 VVQRIVSLFVEPRRRFYINAAEGARRSAEPGVVELVMKAVEANS 73 ++QRIV++FVEPRRRFYINAAEG+RRSAEPGVVE+VMKAVEANS Sbjct: 233 LLQRIVAVFVEPRRRFYINAAEGSRRSAEPGVVEMVMKAVEANS 276