BLASTX nr result
ID: Ziziphus21_contig00044542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044542 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18516.1| hypothetical protein MPH_04318 [Macrophomina phas... 74 3e-11 >gb|EKG18516.1| hypothetical protein MPH_04318 [Macrophomina phaseolina MS6] Length = 657 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 111 MFRRSSYASVAAGTANSNSSQPSTQPTRSGAFAHLLN 1 MFRRSSYASVAAGTAN+NSSQPSTQPTRSGAFAHLLN Sbjct: 1 MFRRSSYASVAAGTANNNSSQPSTQPTRSGAFAHLLN 37