BLASTX nr result
ID: Ziziphus21_contig00044537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044537 (215 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20573.1| Ribosomal protein L13 [Macrophomina phaseolina MS6] 76 9e-12 ref|XP_007584525.1| putative 50s ribosomal protein l13 protein [... 73 7e-11 gb|KKY20963.1| putative 50s ribosomal protein l13 [Diplodia seri... 61 3e-07 >gb|EKG20573.1| Ribosomal protein L13 [Macrophomina phaseolina MS6] Length = 126 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 214 RLKAFEGAAHPYKQNILKVAGQQASSIRDLPEVRKTLSESK 92 RLKAFEGAAHPYKQNILKVAGQ ASSIR+LPEV+KTL+ESK Sbjct: 86 RLKAFEGAAHPYKQNILKVAGQPASSIRELPEVKKTLAESK 126 >ref|XP_007584525.1| putative 50s ribosomal protein l13 protein [Neofusicoccum parvum UCRNP2] gi|485922591|gb|EOD47994.1| putative 50s ribosomal protein l13 protein [Neofusicoccum parvum UCRNP2] Length = 165 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -2 Query: 214 RLKAFEGAAHPYKQNILKVAGQQASSIRDLPEVRKTLSESK 92 RLK FEGAAHPYKQNILK+AGQQASSIRDLPEV++TL+ S+ Sbjct: 125 RLKVFEGAAHPYKQNILKIAGQQASSIRDLPEVKETLAASR 165 >gb|KKY20963.1| putative 50s ribosomal protein l13 [Diplodia seriata] Length = 143 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 202 FEGAAHPYKQNILKVAGQQASSIRDLPEVRKTLSESK 92 FEGAAHPYK+NILKVAGQ+ASSIR+LPEV+K + S+ Sbjct: 107 FEGAAHPYKKNILKVAGQEASSIRELPEVKKAFAGSE 143