BLASTX nr result
ID: Ziziphus21_contig00044242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044242 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001943202.2| PREDICTED: epidermal growth factor receptor ... 62 1e-07 >ref|XP_001943202.2| PREDICTED: epidermal growth factor receptor kinase substrate 8-like [Acyrthosiphon pisum] gi|641663249|ref|XP_008182567.1| PREDICTED: epidermal growth factor receptor kinase substrate 8-like [Acyrthosiphon pisum] gi|641663251|ref|XP_008182568.1| PREDICTED: epidermal growth factor receptor kinase substrate 8-like [Acyrthosiphon pisum] Length = 726 Score = 62.4 bits (150), Expect = 1e-07 Identities = 43/111 (38%), Positives = 58/111 (52%), Gaps = 13/111 (11%) Frame = -3 Query: 295 DDSSDYFDYERQGSDMXXXXXXXXXXVGQYPYEAHSRRYSHDESPDAGS-----DPEFSS 131 DDSSDYF+YE + S M G H ++ D+ D S +P+F++ Sbjct: 476 DDSSDYFEYEHEQSAMMGIRPQYTFNTGGNYSGHHQEQFGPDDRDDTHSLEGESEPDFNT 535 Query: 130 MMPSHVHNVPR-DRD----IGAHSDISADSIERNGGLG---ERFERNQMRW 2 + +H+ PR D++ + A SDISADSIERN G ERFER Q RW Sbjct: 536 LS---LHSPPRMDKERADNMAARSDISADSIERNNASGPGSERFERAQARW 583