BLASTX nr result
ID: Ziziphus21_contig00044183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044183 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10947.1| hypothetical protein MPH_11950 [Macrophomina phas... 67 7e-09 >gb|EKG10947.1| hypothetical protein MPH_11950 [Macrophomina phaseolina MS6] Length = 412 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = -3 Query: 139 EQPEIEHYNAAADGENKGAAIIETSAA-PGDHV-SEAQEQEKTRRWSW 2 EQPEIEHY+A+++GENKG AIIETS+A PGD E QE+EK+R WSW Sbjct: 19 EQPEIEHYSASSNGENKGGAIIETSSATPGDTAPEEQQEREKSRGWSW 66