BLASTX nr result
ID: Ziziphus21_contig00044124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044124 (214 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN11943.1| putative mitochondrial processing peptidase beta ... 73 9e-11 >gb|ABN11943.1| putative mitochondrial processing peptidase beta subunit [Maconellicoccus hirsutus] Length = 253 Score = 72.8 bits (177), Expect = 9e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 214 EVMMKYYYDQEPVIAAVGPTEDVTDYAMLRSYMFWAAF 101 EVMMKYYYDQ+PV+AAVGP ED+TDYAMLRSY FW F Sbjct: 216 EVMMKYYYDQDPVVAAVGPVEDMTDYAMLRSYTFWVPF 253