BLASTX nr result
ID: Ziziphus21_contig00044033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00044033 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12256.1| hypothetical protein MPH_10561 [Macrophomina phas... 76 1e-11 ref|XP_007587040.1| putative ferulic acid esterase protein [Neof... 63 8e-08 >gb|EKG12256.1| hypothetical protein MPH_10561 [Macrophomina phaseolina MS6] Length = 326 Score = 75.9 bits (185), Expect = 1e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 124 CAKSLPSGVQPGVSKNTTIYIEDVKRHYRIHLPENYDANKP 2 C +SLP G++PGVSKNTT+Y++ VKRHYRIHLPENYDA+ P Sbjct: 34 CGQSLPDGIEPGVSKNTTVYVDGVKRHYRIHLPENYDASNP 74 >ref|XP_007587040.1| putative ferulic acid esterase protein [Neofusicoccum parvum UCRNP2] gi|485919039|gb|EOD45487.1| putative ferulic acid esterase protein [Neofusicoccum parvum UCRNP2] Length = 326 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 Query: 124 CAKSLPSGVQPGVSKNTTIYIEDVKRHYRIHLPENYDANKP 2 C LP G++ GVSKNTTI IE V+RHYRIHLP++YDA+ P Sbjct: 34 CGNELPDGIELGVSKNTTIEIEGVERHYRIHLPDSYDASVP 74