BLASTX nr result
ID: Ziziphus21_contig00042962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042962 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007588381.1| putative pheromone-regulated multispanning m... 102 9e-20 gb|KKY28806.1| putative pheromone-regulated multispanning membra... 95 2e-17 gb|EKG21949.1| hypothetical protein MPH_00870 [Macrophomina phas... 93 9e-17 >ref|XP_007588381.1| putative pheromone-regulated multispanning membrane protein [Neofusicoccum parvum UCRNP2] gi|485917079|gb|EOD44156.1| putative pheromone-regulated multispanning membrane protein [Neofusicoccum parvum UCRNP2] Length = 768 Score = 102 bits (255), Expect = 9e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -2 Query: 393 DNEKVGDVGASHPVGLAVSRPAQERTSKVGSIDETTPTNEKSSSGKSWNPF 241 DNEKVGDVGASHPVGLAVSRP QERTSKVGSIDETTPTNEKSS G+SWNPF Sbjct: 717 DNEKVGDVGASHPVGLAVSRPTQERTSKVGSIDETTPTNEKSSGGRSWNPF 767 >gb|KKY28806.1| putative pheromone-regulated multispanning membrane protein [Diplodia seriata] Length = 767 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -2 Query: 393 DNEKVGDVGASHPVGLAVSRPAQERTSKVGSIDETTPTNEKSSSGKSWNPFS 238 +NEKVGDVGASHPVGLAVSRPAQERTSKVGSI+ETTPTNEK S G++WNPFS Sbjct: 717 NNEKVGDVGASHPVGLAVSRPAQERTSKVGSIEETTPTNEK-SGGRNWNPFS 767 >gb|EKG21949.1| hypothetical protein MPH_00870 [Macrophomina phaseolina MS6] Length = 768 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/52 (86%), Positives = 46/52 (88%) Frame = -2 Query: 393 DNEKVGDVGASHPVGLAVSRPAQERTSKVGSIDETTPTNEKSSSGKSWNPFS 238 DNEKVGDVGA HPVGLAVSRP QERTSK GS DETTPTNEK S G+SWNPFS Sbjct: 718 DNEKVGDVGAIHPVGLAVSRPTQERTSKAGSFDETTPTNEK-SGGRSWNPFS 768