BLASTX nr result
ID: Ziziphus21_contig00042957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042957 (236 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289415.1| PREDICTED: uncharacterized protein LOC101292... 74 4e-11 ref|XP_010649382.1| PREDICTED: uncharacterized protein LOC100253... 72 2e-10 emb|CBI37549.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_010093446.1| putative cysteine desulfurase [Morus notabil... 71 3e-10 ref|XP_002517249.1| cysteine desulfurylase, putative [Ricinus co... 71 3e-10 ref|XP_006387161.1| hypothetical protein POPTR_1651s00200g [Popu... 71 3e-10 ref|XP_002531673.1| cysteine desulfurylase, putative [Ricinus co... 70 5e-10 ref|XP_007048349.1| Chloroplastic NIFS-like cysteine desulfurase... 70 8e-10 ref|XP_012489352.1| PREDICTED: uncharacterized protein LOC105802... 69 1e-09 ref|XP_011100148.1| PREDICTED: uncharacterized protein LOC105178... 69 1e-09 ref|XP_012077747.1| PREDICTED: uncharacterized protein LOC105638... 67 4e-09 gb|KDP42628.1| hypothetical protein JCGZ_24402 [Jatropha curcas] 67 4e-09 gb|KDP33229.1| hypothetical protein JCGZ_13501 [Jatropha curcas] 67 4e-09 ref|XP_006382854.1| hypothetical protein POPTR_0005s06130g [Popu... 67 5e-09 ref|XP_012853734.1| PREDICTED: uncharacterized protein LOC105973... 67 7e-09 ref|XP_009630711.1| PREDICTED: uncharacterized protein LOC104120... 67 7e-09 ref|XP_004249899.1| PREDICTED: uncharacterized protein LOC101247... 66 9e-09 ref|XP_011022980.1| PREDICTED: uncharacterized protein LOC105124... 64 6e-08 gb|KHN34073.1| Putative cysteine desulfurase [Glycine soja] 64 6e-08 ref|XP_003524304.2| PREDICTED: uncharacterized protein LOC100777... 64 6e-08 >ref|XP_004289415.1| PREDICTED: uncharacterized protein LOC101292942 [Fragaria vesca subsp. vesca] Length = 647 Score = 73.9 bits (180), Expect = 4e-11 Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 168 CYDLSSNRYESFRKLETYLP-KSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 C S+ ESFRKLE +P KS+SAEL+LSWLRSQ+IG EFDS FGKR+LTYAD Sbjct: 46 CNSSSTTSDESFRKLEQEVPNKSESAELRLSWLRSQVIGASAEFDSPFGKRQLTYAD 102 >ref|XP_010649382.1| PREDICTED: uncharacterized protein LOC100253890 [Vitis vinifera] Length = 649 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 153 SNRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 SN ESFR+LE +P ++S++ KLSWLRSQI+GGD EF S FG RRLTYAD Sbjct: 44 SNGSESFRRLEVGVPNTNSSQKKLSWLRSQIVGGDAEFSSPFGVRRLTYAD 94 >emb|CBI37549.3| unnamed protein product [Vitis vinifera] Length = 670 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 153 SNRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 SN ESFR+LE +P ++S++ KLSWLRSQI+GGD EF S FG RRLTYAD Sbjct: 98 SNGSESFRRLEVGVPNTNSSQKKLSWLRSQIVGGDAEFSSPFGVRRLTYAD 148 >ref|XP_010093446.1| putative cysteine desulfurase [Morus notabilis] gi|587864416|gb|EXB54070.1| putative cysteine desulfurase [Morus notabilis] Length = 688 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 150 NRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 NR +SFR LE +PKS +++LSWLRSQIIGG+ E+DS FGKRRLTYAD Sbjct: 73 NRSDSFRSLEMDVPKSCEDQVRLSWLRSQIIGGNVEYDSPFGKRRLTYAD 122 >ref|XP_002517249.1| cysteine desulfurylase, putative [Ricinus communis] gi|223543620|gb|EEF45149.1| cysteine desulfurylase, putative [Ricinus communis] Length = 633 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 150 NRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 NR ESFR L+ +PKS S+E +L+WLRSQIIG D EF+S FGKRRLTYAD Sbjct: 47 NRSESFRTLDIGVPKSISSERRLAWLRSQIIGDDVEFESPFGKRRLTYAD 96 >ref|XP_006387161.1| hypothetical protein POPTR_1651s00200g [Populus trichocarpa] gi|550305396|gb|ERP46075.1| hypothetical protein POPTR_1651s00200g [Populus trichocarpa] Length = 287 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 141 ESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 ESFR LE +PKS+S E KL+WLRSQI+G D EFDS FG+RRLTYAD Sbjct: 62 ESFRTLEIGVPKSNSTEKKLAWLRSQIVGDDVEFDSPFGRRRLTYAD 108 >ref|XP_002531673.1| cysteine desulfurylase, putative [Ricinus communis] gi|223528704|gb|EEF30717.1| cysteine desulfurylase, putative [Ricinus communis] Length = 598 Score = 70.5 bits (171), Expect = 5e-10 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -3 Query: 150 NRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 NR ESFR LE +PKS S+E +L+WLRSQIIG D EF S FGKRRLTYAD Sbjct: 38 NRSESFRTLEIGVPKSISSEKRLAWLRSQIIGDDVEFCSPFGKRRLTYAD 87 >ref|XP_007048349.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] gi|590708695|ref|XP_007048350.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] gi|508700610|gb|EOX92506.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] gi|508700611|gb|EOX92507.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] Length = 666 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 141 ESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 ESFR LE +PK DS + KLSWLRSQIIGGD +FD+ FG R+LTYAD Sbjct: 49 ESFRTLEMGVPKVDSTDKKLSWLRSQIIGGDAQFDTPFGTRKLTYAD 95 >ref|XP_012489352.1| PREDICTED: uncharacterized protein LOC105802327 [Gossypium raimondii] gi|763773344|gb|KJB40467.1| hypothetical protein B456_007G065500 [Gossypium raimondii] Length = 655 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -3 Query: 141 ESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 ESFR LE +PK +S E KLSWLRSQIIGGD EF+S FG R+LTYAD Sbjct: 53 ESFRNLEMGVPKVNSYEKKLSWLRSQIIGGDAEFESPFGTRKLTYAD 99 >ref|XP_011100148.1| PREDICTED: uncharacterized protein LOC105178381 [Sesamum indicum] Length = 607 Score = 68.9 bits (167), Expect = 1e-09 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -3 Query: 165 YDLSSNRY-ESFRKLETYLPKS-DSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 +D SSNR ESF+ L+ P+S +S E KL WLRSQIIGG EEFD+ FG+RRLTYAD Sbjct: 49 HDFSSNRLDESFQVLDKDFPRSNESTEKKLRWLRSQIIGGTEEFDTPFGRRRLTYAD 105 >ref|XP_012077747.1| PREDICTED: uncharacterized protein LOC105638534 [Jatropha curcas] Length = 630 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -3 Query: 165 YDLSSNRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 Y+ NR ESFR LE +PK S E +L+WLRSQI+G EFDS FGKR LTYAD Sbjct: 45 YNDLCNRSESFRTLEMGIPKDVSPEKRLAWLRSQIVGNGVEFDSPFGKRTLTYAD 99 >gb|KDP42628.1| hypothetical protein JCGZ_24402 [Jatropha curcas] Length = 480 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -3 Query: 165 YDLSSNRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 Y+ NR ESFR LE +PK S E +L+WLRSQI+G EFDS FGKR LTYAD Sbjct: 45 YNDLCNRSESFRTLEMGIPKDVSPEKRLAWLRSQIVGNGVEFDSPFGKRTLTYAD 99 >gb|KDP33229.1| hypothetical protein JCGZ_13501 [Jatropha curcas] Length = 500 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -3 Query: 165 YDLSSNRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 Y+ NR ESFR LE +PK S E +L+WLRSQI+G EFDS FGKR LTYAD Sbjct: 45 YNDLCNRSESFRTLEMGIPKDVSPEKRLAWLRSQIVGNGVEFDSPFGKRTLTYAD 99 >ref|XP_006382854.1| hypothetical protein POPTR_0005s06130g [Populus trichocarpa] gi|550338224|gb|ERP60651.1| hypothetical protein POPTR_0005s06130g [Populus trichocarpa] Length = 624 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 141 ESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 +SFR L+ PKS++ + KL+WLRSQIIG D EFDS FGKRRLTYAD Sbjct: 64 KSFRTLDIGAPKSNTTDKKLAWLRSQIIGDDVEFDSPFGKRRLTYAD 110 >ref|XP_012853734.1| PREDICTED: uncharacterized protein LOC105973258 [Erythranthe guttatus] Length = 643 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -3 Query: 147 RYESFRKLETYLPK-SDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 R ESF+ LE+ +P+ +DS + KL WLRSQIIGGD EFD+ FG+RRLTYAD Sbjct: 42 RIESFQVLESGVPRFTDSTDNKLRWLRSQIIGGDAEFDTPFGRRRLTYAD 91 >ref|XP_009630711.1| PREDICTED: uncharacterized protein LOC104120612 [Nicotiana tomentosiformis] Length = 656 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 150 NRYESFRKLET-YLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 +R ESF LE + KSDSAE KLSWLRSQIIG D +F++ FGKRRLTYAD Sbjct: 42 SRIESFHMLEKGNISKSDSAEKKLSWLRSQIIGEDADFETPFGKRRLTYAD 92 >ref|XP_004249899.1| PREDICTED: uncharacterized protein LOC101247180 [Solanum lycopersicum] Length = 655 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 150 NRYESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 +R ESF E + K++SAE KLSWLRSQIIG + +FDS FGKRRLTYAD Sbjct: 38 SRIESFHVREKAISKTESAEKKLSWLRSQIIGENVDFDSPFGKRRLTYAD 87 >ref|XP_011022980.1| PREDICTED: uncharacterized protein LOC105124597 [Populus euphratica] Length = 646 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 141 ESFRKLETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 ESFR L KS+S E +L+WLRSQI+G D EFDS FG+RRLTYAD Sbjct: 62 ESFRTLNNGGTKSNSTERRLAWLRSQIVGDDVEFDSPFGRRRLTYAD 108 >gb|KHN34073.1| Putative cysteine desulfurase [Glycine soja] Length = 622 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 150 NRYESFRKL-ETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 N ESF+KL E LP ++S E KL WLRSQIIG D EFDS FGKR++ YAD Sbjct: 42 NHSESFKKLVEMGLPCNESVEEKLHWLRSQIIGNDAEFDSPFGKRKVVYAD 92 >ref|XP_003524304.2| PREDICTED: uncharacterized protein LOC100777453 [Glycine max] gi|947111239|gb|KRH59565.1| hypothetical protein GLYMA_05G191100 [Glycine max] Length = 622 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 150 NRYESFRKL-ETYLPKSDSAELKLSWLRSQIIGGDEEFDSVFGKRRLTYAD 1 N ESF+KL E LP ++S E KL WLRSQIIG D EFDS FGKR++ YAD Sbjct: 42 NHSESFKKLVEMGLPCNESVEEKLHWLRSQIIGNDAEFDSPFGKRKVVYAD 92