BLASTX nr result
ID: Ziziphus21_contig00042933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042933 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG22208.1| hypothetical protein MPH_00387 [Macrophomina phas... 76 1e-11 ref|XP_007587941.1| putative class v protein [Neofusicoccum parv... 72 1e-10 >gb|EKG22208.1| hypothetical protein MPH_00387 [Macrophomina phaseolina MS6] Length = 1229 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/49 (75%), Positives = 41/49 (83%), Gaps = 4/49 (8%) Frame = -1 Query: 135 IFGPRPPNRRLLEDPP---GQQAVRFRDSS-NAFFDAPSINMYFNGIYY 1 IFGPRPPNRRLLEDPP G QA RF D++ +AFFD PSINMYFNG+YY Sbjct: 4 IFGPRPPNRRLLEDPPSAPGHQAHRFGDAAGSAFFDTPSINMYFNGVYY 52 >ref|XP_007587941.1| putative class v protein [Neofusicoccum parvum UCRNP2] gi|485917753|gb|EOD44587.1| putative class v protein [Neofusicoccum parvum UCRNP2] Length = 385 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 135 IFGPRPPNRRLLEDPPGQQAVRFRDSSNAFFDAPSINMYFNGIYY 1 +FGPRPPNRRLL D Q A RF D S++FFD+P+INMYFNG+YY Sbjct: 4 VFGPRPPNRRLLHDSHDQPASRFGDLSSSFFDSPTINMYFNGVYY 48