BLASTX nr result
ID: Ziziphus21_contig00042853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042853 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY15139.1| hypothetical protein UCDDS831_g07865 [Diplodia se... 60 6e-07 >gb|KKY15139.1| hypothetical protein UCDDS831_g07865 [Diplodia seriata] Length = 88 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = -2 Query: 146 QPMDSMRSAFVGTQQFFHNAGSSARDRVAG-VEWDQAPKHIQDYITEHP 3 QPM S+ +A VGTQ H A +S RDR+AG VEW Q PK +DY+ +HP Sbjct: 2 QPMHSICNALVGTQHLLHTAATSTRDRIAGAVEWRQLPKQTKDYVAQHP 50